Project name: query_structure

Status: done

Started: 2026-03-16 23:09:26
Settings
Chain sequence(s) A: ESCVFIPCLTSAIGCSCKSKVCYRNGIPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)
Show buried residues

Minimal score value
-1.7306
Maximal score value
2.6657
Average score
0.2737
Total score value
8.2112

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.1725
2 S A 0.3387
3 C A 1.0066
4 V A 1.9142
5 F A 2.6657
6 I A 1.9102
7 P A 1.0808
8 C A 0.0000
9 L A 1.6677
10 T A 1.0845
11 S A 0.7541
12 A A 1.1157
13 I A 1.8769
14 G A 0.2503
15 C A 0.0000
16 S A -0.3635
17 C A -0.4232
18 K A -1.7306
19 S A -1.2274
20 K A -1.0664
21 V A -0.3792
22 C A 0.0000
23 Y A -0.5198
24 R A -0.7698
25 N A -1.3009
26 G A -0.5425
27 I A 1.1175
28 P A 0.1366
29 C A 0.2276
30 G A -0.4401
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018