Project name: query_structure

Status: done

Started: 2026-03-16 22:58:10
Settings
Chain sequence(s) A: CGADQFRCGNGSCVPRAWRCDGVDDCGDGSDEAPEICETPTCQSNEFRCRSGRCIPQHWLCDGLNDCGDGSDESQQCSAPASEPPGSLCGEGLFTCRSTNICISHAWVCDGVDDCEDNSDENNCSAPASEPPGSL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-3.1942
Maximal score value
1.3369
Average score
-1.1869
Total score value
-160.2377

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A -0.2463
2 G A -0.9993
3 A A -1.0825
4 D A -2.3361
5 Q A -1.7481
6 F A -1.3991
7 R A -2.2863
8 C A 0.0000
9 G A -2.0572
10 N A -2.5246
11 G A -1.7184
12 S A -1.3211
13 C A -0.7819
14 V A 0.0000
15 P A -1.0827
16 R A -1.7030
17 A A -0.7649
18 W A -0.4842
19 R A -1.1243
20 C A -1.1397
21 D A -1.7145
22 G A -0.9440
23 V A -0.1582
24 D A -2.2641
25 D A -1.7491
26 C A 0.0000
27 G A -2.2584
28 D A -3.1342
29 G A -2.1640
30 S A -2.2224
31 D A 0.0000
32 E A -1.8006
33 A A -1.6776
34 P A -1.7758
35 E A -2.3991
36 I A -1.1576
37 C A -1.6358
38 E A -2.4875
39 T A -1.5492
40 P A -1.5413
41 T A -0.9795
42 C A -1.6256
43 Q A -2.0715
44 S A -1.6165
45 N A -2.2853
46 E A -2.1817
47 F A -1.6543
48 R A -2.5137
49 C A 0.0000
50 R A -3.1714
51 S A -2.6099
52 G A -2.5882
53 R A -3.0428
54 C A -1.9135
55 I A 0.0000
56 P A -1.3046
57 Q A -1.8655
58 H A -1.4826
59 W A -0.6029
60 L A -0.6363
61 C A -0.8896
62 D A -1.6101
63 G A -0.7411
64 L A 0.1146
65 N A -1.5351
66 D A -1.2848
67 C A 0.0000
68 G A -2.1930
69 D A -3.0600
70 G A -1.9530
71 S A 0.0000
72 D A 0.0000
73 E A -1.4918
74 S A -1.7709
75 Q A -1.8782
76 Q A -1.8201
77 C A -1.1218
78 S A -1.0252
79 A A -0.6647
80 P A -0.3960
81 A A -0.3026
82 S A -0.7596
83 E A -1.1352
84 P A -0.7165
85 P A -0.6467
86 G A -0.5500
87 S A -0.4556
88 L A 0.1416
89 C A 0.0000
90 G A -0.8843
91 E A -1.9629
92 G A -0.9322
93 L A 0.4078
94 F A 0.3173
95 T A -0.0729
96 C A 0.0000
97 R A -2.6078
98 S A -1.9694
99 T A -1.5137
100 N A -1.2498
101 I A -0.1112
102 C A 0.7335
103 I A 0.0000
104 S A 0.1388
105 H A -0.5318
106 A A -0.1053
107 W A 0.2136
108 V A -0.3613
109 C A -0.9258
110 D A -1.3655
111 G A -0.8772
112 V A -0.2469
113 D A -2.2943
114 D A -1.5042
115 C A 0.0000
116 E A -2.9328
117 D A -3.0141
118 N A -3.1942
119 S A 0.0000
120 D A 0.0000
121 E A -1.9062
122 N A -2.5464
123 N A -1.7400
124 C A -0.5549
125 S A -0.4835
126 A A -0.2872
127 P A -0.6085
128 A A -0.5674
129 S A -1.3036
130 E A -2.2340
131 P A -1.5236
132 P A -1.1639
133 G A -0.7047
134 S A 0.2202
135 L A 1.3369
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018