Project name: obj1 [mutate: GP10C, LS45C, YW59C, WT110C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LS45C,GP10C,YW59C,WT110C
Energy difference between WT (input) and mutated protein (by FoldX)	9.297 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:40)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:03)

• Minimal score value: -3.2282
• Maximal score value: 1.8077
• Average score: -0.6967
• Total score value: -83.5982

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0060
2	V	C	-1.0132
3	Q	C	-1.3701
4	L	C	0.0000
5	V	C	0.4792
6	E	C	0.1798
7	S	C	-0.3753
8	G	C	-0.7498
9	G	C	0.1455
10	P	C	0.9856	mutated: GP10C
11	L	C	1.4577
12	V	C	-0.0393
13	Q	C	-1.3448
14	P	C	-1.4926
15	G	C	-1.4157
16	G	C	-0.9876
17	S	C	-1.2450
18	L	C	-0.9575
19	R	C	-2.1297
20	L	C	0.0000
21	S	C	-0.5229
22	C	C	0.0000
23	A	C	-0.1957
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.0693
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-1.0633
40	A	C	-1.3628
41	P	C	-1.3276
42	G	C	-1.6237
43	K	C	-2.5360
44	G	C	-1.8862
45	S	C	-1.2745	mutated: LS45C
46	E	C	-1.2138
47	W	C	-0.0473
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5727
53	G	C	-1.2426
54	S	C	-1.2252
55	G	C	-1.0730
56	G	C	-0.7214
57	S	C	-0.2759
58	T	C	0.2167
59	W	C	0.6146	mutated: YW59C
60	Y	C	-0.3573
61	A	C	-1.1407
62	D	C	-2.3449
63	S	C	-1.7152
64	V	C	0.0000
65	K	C	-2.3855
66	G	C	-1.6177
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6718
70	I	C	0.0000
71	S	C	-0.5587
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6693
81	L	C	0.0000
82	Q	C	-1.2401
83	M	C	0.0000
84	N	C	-1.3380
85	S	C	-1.2349
86	L	C	0.0000
87	R	C	-2.4741
88	A	C	-1.8915
89	E	C	-2.3445
90	D	C	0.0000
91	T	C	-0.4410
92	A	C	0.0000
93	I	C	0.8882
94	Y	C	0.0000
95	Y	C	0.3030
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.9597
101	D	C	-3.2282
102	G	C	-2.0027
103	F	C	-1.1355
104	N	C	-2.3387
105	K	C	-3.0413
106	G	C	-1.5872
107	F	C	-0.4827
108	D	C	-0.9689
109	Y	C	-0.3921
110	T	C	-0.0796	mutated: WT110C
111	G	C	0.0000
112	Q	C	-1.0286
113	G	C	0.0171
114	T	C	0.6484
115	L	C	1.8077
116	V	C	0.0000
117	T	C	0.3603
118	V	C	0.0000
119	S	C	-0.7792
120	S	C	-1.0622