Project name: f0f74605aa6e5aa

Chain sequence(s)	A: AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)

• Minimal score value: -3.2705
• Maximal score value: 1.0905
• Average score: -0.84
• Total score value: -96.5975

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
18	A	A	-0.0091
19	F	A	-0.0339
20	T	A	-0.1413
21	V	A	0.0000
22	T	A	-0.9261
23	V	A	-1.2183
24	P	A	-1.2779
25	K	A	-2.4007
26	D	A	-2.5161
27	L	A	-0.4332
28	Y	A	0.1906
29	V	A	1.0905
30	V	A	0.0000
31	E	A	-2.0464
32	Y	A	-1.1293
33	G	A	-1.7239
34	S	A	-1.9737
35	N	A	-2.3601
36	M	A	0.0000
37	T	A	-0.6428
38	I	A	0.0000
39	E	A	-1.0896
40	C	A	0.0000
41	K	A	-0.8335
42	F	A	0.0000
43	P	A	-0.5162
44	V	A	-1.3338
45	E	A	-2.8950
46	K	A	-3.1180
47	Q	A	-2.5159
48	L	A	-1.3969
49	D	A	-1.9927
50	L	A	-0.2913
51	A	A	-0.2946
52	A	A	-0.2725
53	L	A	0.0000
54	I	A	0.3667
55	V	A	0.0000
56	Y	A	0.2029
57	W	A	0.0000
58	E	A	-1.8667
59	M	A	0.0000
60	E	A	-2.9989
61	D	A	-3.2705
62	K	A	-2.3248
63	N	A	-1.5033
64	I	A	0.0000
65	I	A	0.0000
66	Q	A	-0.5573
67	F	A	0.0000
68	V	A	-0.3596
69	H	A	-0.8456
70	G	A	-1.4768
71	E	A	-2.0584
72	E	A	-1.6503
73	D	A	-0.7056
74	L	A	-0.0124
75	K	A	-0.6531
76	V	A	0.5330
77	Q	A	0.0000
78	H	A	-1.2164
79	S	A	-1.3020
80	S	A	-1.4016
81	Y	A	0.0000
82	R	A	-2.7333
83	Q	A	-2.6228
84	R	A	-2.3447
85	A	A	0.0000
86	R	A	-2.7197
87	L	A	0.0000
88	L	A	-1.7022
89	K	A	-2.8188
90	D	A	-2.4364
91	Q	A	-1.2977
92	L	A	0.0000
93	S	A	-0.9508
94	L	A	0.4348
95	G	A	0.0000
96	N	A	-0.5790
97	A	A	0.0000
98	A	A	0.0000
99	L	A	0.0000
100	Q	A	-1.1131
101	I	A	0.0000
102	T	A	-2.1959
103	D	A	-2.7719
104	V	A	0.0000
105	K	A	-1.4673
106	L	A	0.0082
107	Q	A	-0.7871
108	D	A	0.0000
109	A	A	-0.2387
110	G	A	-0.3706
111	V	A	-0.8279
112	Y	A	0.0000
113	R	A	-1.7759
114	C	A	0.0000
115	M	A	0.1422
116	I	A	0.0000
117	S	A	0.1462
118	Y	A	0.0000
119	G	A	-0.6226
120	G	A	-0.5495
121	A	A	-0.0402
122	D	A	0.0534
123	Y	A	0.2476
124	K	A	-1.3600
125	R	A	-2.4067
126	I	A	0.0000
127	T	A	-0.6983
128	V	A	0.0000
129	K	A	-0.4157
130	V	A	-0.7393
131	N	A	-1.1368
132	A	A	-0.7046