Project name: b728504c5a850bb [mutate: GF14A] [mutate: FV14A]

Chain sequence(s)	A: SKIKGSRHWGFILFKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	FV14A
Energy difference between WT (input) and mutated protein (by FoldX)	1.80304 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:31)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:33)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)

• Minimal score value: -4.4114
• Maximal score value: 3.4428
• Average score: -0.9933
• Total score value: -108.268

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.7059
2	K	A	-1.3324
3	I	A	0.3085
4	K	A	-1.6953
5	G	A	-1.3316
6	S	A	-1.6246
7	R	A	-2.6242
8	H	A	-1.4097
9	W	A	0.7266
10	G	A	1.5577
11	F	A	3.4428
12	I	A	2.7625
13	L	A	2.9490
14	V	A	1.6427	mutated: FV14A
15	K	A	-1.5060
16	R	A	-1.8323
17	G	A	-1.7653
18	E	A	-2.6566
19	P	A	-1.5728
20	P	A	-1.4663
21	P	A	-1.4926
22	G	A	-1.6016
23	K	A	-2.4020
24	P	A	-1.9741
25	A	A	-1.9851
26	D	A	-2.9463
27	D	A	-2.8694
28	A	A	-1.2493
29	G	A	-0.5142
30	L	A	-0.2511
31	V	A	0.0560
32	S	A	-1.1962
33	R	A	-1.8214
34	H	A	-1.2323
35	W	A	0.4792
36	G	A	0.0000
37	F	A	2.7174
38	I	A	2.0730
39	L	A	1.9040
40	G	A	-0.4948
41	K	A	-2.9949
42	R	A	-3.1147
43	G	A	-3.0557
44	E	A	-2.8695
45	P	A	-1.8877
46	P	A	-1.5989
47	P	A	-1.4728
48	G	A	-1.5967
49	K	A	-2.3678
50	P	A	-2.1602
51	A	A	-1.8942
52	D	A	-3.1478
53	D	A	-2.7445
54	A	A	-1.5599
55	G	A	-0.1637
56	L	A	0.9555
57	V	A	1.0476
58	S	A	0.0521
59	R	A	-0.8519
60	H	A	-1.1592
61	W	A	0.1354
62	G	A	1.3870
63	F	A	2.5236
64	I	A	1.4704
65	L	A	1.1372
66	G	A	-1.3900
67	K	A	-4.0459
68	R	A	-4.4114
69	G	A	-3.8021
70	E	A	-3.3060
71	P	A	-2.1881
72	P	A	-1.5551
73	P	A	-1.3674
74	G	A	-1.6214
75	K	A	-2.3708
76	P	A	-1.9636
77	A	A	-2.0366
78	D	A	-2.9243
79	D	A	-2.6699
80	A	A	-1.0659
81	G	A	0.1984
82	L	A	1.6501
83	V	A	1.6221
84	S	A	0.1498
85	R	A	-1.3478
86	H	A	-1.2022
87	W	A	0.3132
88	G	A	1.1577
89	F	A	2.7505
90	I	A	1.6862
91	L	A	1.2323
92	G	A	-1.4113
93	K	A	-3.3283
94	R	A	-4.2753
95	G	A	-3.8314
96	E	A	-3.2564
97	P	A	-1.9233
98	P	A	-1.3824
99	P	A	-1.4621
100	G	A	-1.6027
101	K	A	-2.4351
102	P	A	-2.0679
103	A	A	-1.9094
104	D	A	-3.1123
105	D	A	-2.6284
106	A	A	-0.6400
107	G	A	-0.0018
108	L	A	1.9466
109	V	A	2.4270