Project name: f214a6e453fd847

Chain sequence(s)	A: TSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)

• Minimal score value: -3.0311
• Maximal score value: 0.8318
• Average score: -0.9817
• Total score value: -75.5907

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
103	T	A	-0.3423
104	S	A	-0.0812
105	D	A	-0.4417
106	L	A	0.0000
107	I	A	-0.2313
108	V	A	0.0000
109	L	A	-0.1214
110	G	A	-0.2148
111	L	A	0.0000
112	P	A	0.0000
113	W	A	-0.5484
114	K	A	-1.6522
115	T	A	0.0000
116	T	A	-1.8120
117	E	A	-2.3176
118	Q	A	-2.7915
119	D	A	-2.8861
120	L	A	0.0000
121	K	A	-2.8914
122	E	A	-2.8940
123	Y	A	-1.5310
124	F	A	0.0000
125	S	A	-1.3195
126	T	A	-0.7195
127	F	A	-0.5806
128	G	A	-1.0995
129	E	A	-1.8027
130	V	A	-0.5640
131	L	A	0.8318
132	M	A	0.1784
133	V	A	0.0000
134	Q	A	-1.6332
135	V	A	-1.6402
136	K	A	-2.3906
137	K	A	-3.0311
138	D	A	-2.3702
139	L	A	-0.4913
140	K	A	-1.6762
141	T	A	-1.4012
142	G	A	-1.8797
143	H	A	-2.4346
144	S	A	-2.1967
145	K	A	-2.5356
146	G	A	-1.0328
147	F	A	-0.4111
148	G	A	0.0000
149	F	A	-0.2664
150	V	A	0.0000
151	R	A	-0.3606
152	F	A	0.0000
153	T	A	-0.7964
154	E	A	-1.5614
155	Y	A	-0.3012
156	E	A	-1.6251
157	T	A	0.0000
158	Q	A	0.0000
159	V	A	-0.1928
160	K	A	-0.8657
161	V	A	0.0000
162	M	A	-0.6470
163	S	A	-1.2104
164	Q	A	-2.0086
165	R	A	-2.3864
166	H	A	0.0000
167	M	A	-0.6415
168	I	A	0.0000
169	D	A	-2.4335
170	G	A	-1.8445
171	R	A	-2.2510
172	W	A	-0.7964
173	C	A	0.0000
174	D	A	-2.0435
175	C	A	0.0000
176	K	A	-1.1829
177	L	A	0.3943
178	P	A	-0.4556
179	N	A	-1.1571