Project name: query_structure

Status: done

Started: 2026-03-16 23:36:53
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYGITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAYHSYDDIYYALSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:29)
Show buried residues

Minimal score value
-2.606
Maximal score value
2.1789
Average score
-0.2993
Total score value
-29.0358

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4114
2 S A -0.1275
3 S A 0.3263
4 V A 1.4571
5 S A 0.5000
6 S A 0.2241
7 V A -0.1143
8 P A 0.0000
9 T A -1.6259
10 K A -2.6060
11 L A 0.0000
12 E A -1.5693
13 V A 0.2876
14 V A 1.6317
15 A A 0.9398
16 A A 0.3006
17 T A -0.3843
18 P A -0.8106
19 T A -0.5251
20 S A -0.3152
21 L A 0.0000
22 L A 0.7912
23 I A 0.0000
24 S A -0.6534
25 W A 0.0000
26 D A -2.5125
27 A A -1.1923
28 S A -0.7933
29 S A -0.5527
30 S A -0.3590
31 S A -0.1141
32 V A 0.2439
33 S A 0.1859
34 H A -0.0828
35 Y A 0.0000
36 G A 0.0000
37 I A 0.0000
38 T A -0.4663
39 Y A -0.3578
40 G A 0.0000
41 E A -1.2771
42 T A -1.1768
43 G A -1.2054
44 G A -1.3071
45 N A -1.5177
46 S A -0.8449
47 P A -0.3562
48 V A 0.3646
49 Q A -0.9917
50 E A -1.6201
51 F A -0.5538
52 T A -0.1460
53 V A -0.0100
54 P A -0.3641
55 G A -0.3828
56 S A -0.3983
57 S A -0.4666
58 S A -0.6775
59 T A -0.2235
60 A A 0.0000
61 T A 0.2545
62 I A 0.0000
63 S A -0.4705
64 G A -0.6837
65 L A 0.0000
66 S A -0.8199
67 P A -0.9804
68 G A -1.0596
69 V A -0.8786
70 D A -1.7679
71 Y A 0.0000
72 T A -0.7553
73 I A 0.0000
74 T A -0.1780
75 V A 0.0000
76 Y A 0.4793
77 A A 0.0000
78 Y A 1.2257
79 H A 0.0000
80 S A 0.7238
81 Y A 0.6008
82 D A -1.4334
83 D A -1.1114
84 I A 1.5091
85 Y A 2.1789
86 Y A 2.1089
87 A A 1.2494
88 L A 0.7211
89 S A 0.0827
90 P A 0.0156
91 S A -0.4096
92 S A -0.6178
93 I A -0.7208
94 N A -1.6477
95 Y A -1.3496
96 R A -2.2924
97 T A -1.1684
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018