| Chain sequence(s) |
A: QDCPECKLRENKYFFKLGVPIYQCKGCCFSRAYPTPARSRKTMLVPKNITSESTCCVAKAFIRVTVMGNIKLENHTQCYCSTCYH
B: RGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPAIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFRDQPLACA input PDB |
| Selected Chain(s) | A,B |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | Yes |
| Automated mutations | No |
| Mutated residues | AS111B,DK105B |
| Energy difference between WT (input) and mutated protein (by FoldX) | 0.0 kcal/mol |
| Error log | One of Aggrescan3D modules (CABS) encountered an error.
Traceback (most recent call last):
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 189, in _run_module_as_main
mod_name, mod_spec, code = _get_main_module_details(_Error)
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 238, in _get_main_module_details
return _get_module_details(main_name)
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 157, in _get_module_details
code = loader.get_code(mod_name)
File "<frozen importlib._bootstrap_external>", line 1017, in get_code
File "<frozen importlib._bootstrap_external>", line 947, in source_to_code
File "<frozen importlib._bootstrap>", line 241, in _call_with_frames_removed
File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/__main__.py", line 31
print __version__
^^^^^^^^^^^^^^^^^
SyntaxError: Missing parentheses in call to 'print'. Did you mean print(...)?
One of Aggrescan3D modules (CABS) encountered an error.
Traceback (most recent call last):
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 189, in _run_module_as_main
mod_name, mod_spec, code = _get_main_module_details(_Error)
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 238, in _get_main_module_details
return _get_module_details(main_name)
File "/home/users/lcbio/mambaforge/lib/python3.10/runpy.py", line 157, in _get_module_details
code = loader.get_code(mod_name)
File "<frozen importlib._bootstrap_external>", line 1017, in get_code
File "<frozen importlib._bootstrap_external>", line 947, in source_to_code
File "<frozen importlib._bootstrap>", line 241, in _call_with_frames_removed
File "/home/users/lcbio/anaconda2/envs/exec/lib/python2.7/site-packages/CABS/__main__.py", line 31
print __version__
^^^^^^^^^^^^^^^^^
SyntaxError: Missing parentheses in call to 'print'. Did you mean print(...)?
|