Project name: f2cbb7c0802bbb0

Chain sequence(s)	A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKVSEYARKKLAATERTYGLRFKDQRVHVVSKSERVKMPKKKKSCTQKEAEWENDNKPPKEWPEGPGPGMWIFLLSNKLSGHSVGPGPGSGHSVTSDSNFVAALAAYSVIPMLMSFGPGPGSSLPNKLQY
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:47)

• Minimal score value: -3.8686
• Maximal score value: 6.0038
• Average score: -0.0188
• Total score value: -3.6835

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.3946
2	R	A	0.5925
3	V	A	2.8995
4	L	A	3.5584
5	Y	A	3.6751
6	L	A	3.8869
7	L	A	4.8150
8	F	A	5.3797
9	S	A	4.9042
10	F	A	5.7578
11	L	A	5.6439
12	F	A	5.9390
13	I	A	6.0038
14	F	A	5.5738
15	L	A	4.7346
16	M	A	3.6507
17	P	A	2.6048
18	L	A	2.8211
19	P	A	1.0125
20	G	A	0.9785
21	V	A	2.5297
22	F	A	2.5271
23	G	A	0.8112
24	G	A	0.1229
25	I	A	-0.0470
26	G	A	-0.6645
27	D	A	-0.4377
28	P	A	0.5260
29	V	A	1.3880
30	T	A	0.2700
31	C	A	0.0000
32	L	A	1.1876
33	K	A	-0.5969
34	S	A	-0.2458
35	G	A	-0.5741
36	A	A	0.0000
37	I	A	0.5885
38	C	A	0.9375
39	H	A	0.4912
40	P	A	1.0116
41	V	A	2.2000
42	F	A	2.1313
43	C	A	-0.0999
44	P	A	-1.4155
45	R	A	-2.7060
46	R	A	-3.1715
47	Y	A	-2.2174
48	K	A	-2.7691
49	Q	A	-1.5648
50	I	A	-0.8526
51	G	A	-0.9342
52	T	A	-0.8056
53	C	A	0.0000
54	G	A	-0.3412
55	L	A	0.5919
56	P	A	0.1746
57	G	A	0.2920
58	T	A	0.4000
59	K	A	-0.2033
60	C	A	0.0000
61	C	A	0.0000
62	K	A	-1.7685
63	K	A	-2.7264
64	P	A	-2.1793
65	E	A	-2.2347
66	A	A	-0.8366
67	A	A	-1.3846
68	K	A	-1.5534
69	V	A	0.1664
70	S	A	-1.2130
71	E	A	-2.5261
72	Y	A	-0.8831
73	A	A	-1.4486
74	R	A	-3.0315
75	K	A	-3.1175
76	K	A	-2.7760
77	L	A	-1.3714
78	A	A	-1.7942
79	A	A	-1.8246
80	T	A	-1.2004
81	E	A	-1.5601
82	R	A	-2.0199
83	T	A	-0.4946
84	Y	A	0.3060
85	G	A	-0.4742
86	L	A	-0.0586
87	R	A	-1.6143
88	F	A	-0.3476
89	K	A	-2.6023
90	D	A	-3.2673
91	Q	A	-2.5945
92	R	A	-2.3834
93	V	A	0.5582
94	H	A	0.5712
95	V	A	2.1365
96	V	A	1.8921
97	S	A	-0.0892
98	K	A	-1.9598
99	S	A	-1.9834
100	E	A	-3.1709
101	R	A	-2.4891
102	V	A	-0.2066
103	K	A	-1.3363
104	M	A	-0.2740
105	P	A	-1.4215
106	K	A	-3.2265
107	K	A	-3.7270
108	K	A	-3.8686
109	K	A	-3.1071
110	S	A	-1.3107
111	C	A	-0.2601
112	T	A	-0.8533
113	Q	A	-2.3218
114	K	A	-3.3111
115	E	A	-3.2962
116	A	A	-2.1521
117	E	A	-2.5387
118	W	A	-1.3254
119	E	A	-2.9327
120	N	A	-3.4826
121	D	A	-3.8062
122	N	A	-3.6197
123	K	A	-3.0546
124	P	A	-2.2948
125	P	A	-1.9928
126	K	A	-2.5400
127	E	A	-2.5012
128	W	A	-0.7970
129	P	A	-1.3600
130	E	A	-2.2336
131	G	A	-1.4755
132	P	A	-0.9207
133	G	A	-0.8343
134	P	A	0.0984
135	G	A	0.9744
136	M	A	2.1422
137	W	A	3.2505
138	I	A	4.0208
139	F	A	3.6620
140	L	A	2.9478
141	L	A	2.8234
142	S	A	1.3927
143	N	A	-0.3894
144	K	A	-0.9860
145	L	A	0.3230
146	S	A	-0.6801
147	G	A	-1.0147
148	H	A	-0.8406
149	S	A	-0.1587
150	V	A	0.9790
151	G	A	-0.0564
152	P	A	-0.4383
153	G	A	-0.7149
154	P	A	-0.9160
155	G	A	-0.9403
156	S	A	-1.0221
157	G	A	-1.0442
158	H	A	-0.8964
159	S	A	-0.0327
160	V	A	1.0399
161	T	A	0.0115
162	S	A	-0.1982
163	D	A	-1.0348
164	S	A	-0.4767
165	N	A	-0.2591
166	F	A	1.9648
167	V	A	2.4008
168	A	A	1.4462
169	A	A	1.8039
170	L	A	2.6462
171	A	A	2.0739
172	A	A	1.8306
173	Y	A	2.3743
174	S	A	1.6618
175	V	A	2.7098
176	I	A	2.9016
177	P	A	2.1383
178	M	A	2.7147
179	L	A	3.2959
180	M	A	2.7013
181	S	A	1.8273
182	F	A	2.2836
183	G	A	0.5896
184	P	A	-0.3528
185	G	A	-0.6722
186	P	A	-0.8971
187	G	A	-0.7118
188	S	A	-0.2884
189	S	A	0.0839
190	L	A	0.7137
191	P	A	-0.6065
192	N	A	-1.6285
193	K	A	-1.6040
194	L	A	0.0622
195	Q	A	-0.2154
196	Y	A	0.8738