Project name: query_structure

Status: done

Started: 2026-03-17 00:27:45
Settings
Chain sequence(s) A: QVQLQESGGGLVQAGGSLRLSCTASDRAFSTYNMGWFRQAPGKEREFVAGINWTGRSADYPDSVKGRFTISRDNAKNAVYLQMNSLKPEDTAVYYCAAKRYGSRSDYSWNDYDSWGQGTQVTVSSGAAEPEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:41)
Show buried residues

Minimal score value
-3.6819
Maximal score value
1.1204
Average score
-1.0394
Total score value
-137.1997

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.7521
2 V A 0.0000
3 Q A -1.9330
4 L A 0.0000
5 Q A -1.4700
6 E A 0.0000
7 S A -1.0977
8 G A -0.9768
9 G A -0.7698
10 G A -0.0471
11 L A 1.1204
12 V A 0.1650
13 Q A -0.9711
14 A A -1.3083
15 G A -1.2239
16 G A -0.8052
17 S A -1.1918
18 L A -1.0203
19 R A -2.1237
20 L A 0.0000
21 S A -0.7958
22 C A 0.0000
23 T A -1.1213
24 A A -1.5208
25 S A -1.5341
26 D A -1.8212
27 R A -2.3682
28 A A -1.2524
29 F A 0.0000
30 S A -0.7980
31 T A -0.3471
32 Y A 0.0000
33 N A -0.3415
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A -1.5971
39 Q A -2.1255
40 A A -2.0410
41 P A -1.3456
42 G A -1.9049
43 K A -3.4220
44 E A -3.6819
45 R A -2.9819
46 E A -3.0568
47 F A -1.3773
48 V A 0.0000
49 A A 0.0000
50 G A 0.0000
51 I A 0.0000
52 N A -0.6872
53 W A -0.2677
54 T A -0.7549
55 G A -1.3663
56 R A -2.0230
57 S A -1.3235
58 A A -0.8901
59 D A -1.1002
60 Y A -1.2357
61 P A -1.7276
62 D A -2.6443
63 S A -1.6357
64 V A 0.0000
65 K A -2.7759
66 G A -1.8158
67 R A -1.6748
68 F A 0.0000
69 T A -0.9516
70 I A 0.0000
71 S A -0.6510
72 R A -1.2213
73 D A -1.7056
74 N A -1.9155
75 A A -1.6381
76 K A -2.4575
77 N A -2.0266
78 A A 0.0000
79 V A 0.0000
80 Y A -0.6212
81 L A 0.0000
82 Q A -1.2329
83 M A 0.0000
84 N A -1.4087
85 S A -1.1535
86 L A 0.0000
87 K A -2.0767
88 P A -1.7552
89 E A -2.2377
90 D A 0.0000
91 T A -0.8436
92 A A 0.0000
93 V A -0.4014
94 Y A 0.0000
95 Y A -0.5641
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 K A 0.0000
100 R A -1.5778
101 Y A -0.3082
102 G A -1.0563
103 S A -1.8114
104 R A -2.4238
105 S A -1.8835
106 D A -2.0024
107 Y A -0.1826
108 S A -0.8862
109 W A -1.0170
110 N A -2.3597
111 D A -3.0560
112 Y A 0.0000
113 D A -2.5561
114 S A 0.0000
115 W A -0.6467
116 G A -0.8851
117 Q A -1.4882
118 G A 0.0000
119 T A -1.0019
120 Q A -1.0952
121 V A 0.0000
122 T A -0.1740
123 V A 0.0000
124 S A -0.6997
125 S A -1.0306
126 G A -0.9521
127 A A -0.9557
128 A A -1.4705
129 E A -2.4679
130 P A -1.9640
131 E A -2.4341
132 A A -1.1883
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018