Project name: Mb5-11_LVFIVI

Status: done

Started: 2026-07-06 06:35:31
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTITVYAVTWYPRYGYGESGPVSINYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:06)
Show buried residues

Minimal score value
-2.7137
Maximal score value
1.4658
Average score
-0.7182
Total score value
-78.2848

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.1962
2 Q A -1.0009
3 A A 0.0000
4 N A -1.9529
5 S A -1.5649
6 G A 0.0000
7 S A -1.4039
8 L A 0.0000
9 E A -2.0303
10 V A -0.8759
11 V A -0.3211
12 E A -1.6526
13 A A -1.2931
14 S A -1.4301
15 P A -1.6805
16 T A -1.0924
17 S A -1.1371
18 L A 0.0000
19 Q A -1.1632
20 L A 0.0000
21 S A -1.2940
22 W A 0.0000
23 D A -2.5052
24 A A -1.6240
25 F A 0.0000
26 H A -1.2870
27 R A 0.0000
28 Y A 0.8378
29 H A 0.2280
30 N A -0.5718
31 G A 0.1234
32 F A 1.4658
33 T A 0.6938
34 H A 0.0721
35 P A -0.3029
36 V A -0.8271
37 R A -0.9251
38 Y A -0.7251
39 Y A 0.0000
40 R A -0.7995
41 V A 0.0000
42 T A 0.0000
43 Y A -0.3651
44 G A -0.5709
45 E A -1.2533
46 T A -1.0574
47 G A -1.1314
48 G A -1.2534
49 N A -1.4660
50 S A -0.8125
51 P A -0.3471
52 V A 0.3440
53 Q A -1.2131
54 E A -1.8671
55 F A -0.7810
56 T A -0.2384
57 V A -0.4473
58 P A -0.9160
59 G A -1.1419
60 S A -1.2821
61 K A -1.9942
62 S A -1.3782
63 T A -1.0307
64 A A 0.0000
65 T A -0.4569
66 F A 0.0000
67 S A -0.7751
68 G A -0.9604
69 L A 0.0000
70 K A -2.2163
71 P A -1.8229
72 G A -1.0859
73 V A -0.9752
74 D A -1.9451
75 Y A 0.0000
76 T A -0.6709
77 I A 0.0000
78 T A -0.4817
79 V A 0.0000
80 Y A -0.3878
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5623
85 Y A 0.0000
86 P A -0.4825
87 R A -1.1237
88 Y A 0.6754
89 G A 0.6265
90 Y A 0.9938
91 G A 0.4006
92 E A -0.6637
93 S A 0.0000
94 G A -1.0224
95 P A -0.6291
96 V A 0.0000
97 S A -0.5590
98 I A -0.5634
99 N A -1.6271
100 Y A -1.4692
101 R A -2.3720
102 T A 0.0000
103 E A -1.9012
104 L A -0.9653
105 D A -2.5519
106 K A -2.7137
107 P A -1.7846
108 S A -1.6319
109 Q A -1.6579
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018