Project name: f80d902df090eb2fc8149cb9f2fc4d42

Status: done

Started: 2026-03-07 00:26:53
Settings
Chain sequence(s) B: GDYSIAKKAEEKQKANVLQQALAEHYSAEQASALSKLSPEEQQKLGQEILAEKLAGSGC
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:02)
Show buried residues

Minimal score value
-4.9686
Maximal score value
0.5156
Average score
-1.862
Total score value
-109.8553

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -0.4369
2 D B -0.9644
3 Y B 0.4781
4 S B -0.0057
5 I B 0.5156
6 A B -0.8812
7 K B -2.3145
8 K B -2.9944
9 A B -2.7747
10 E B -4.5820
11 E B -4.9686
12 K B -4.8792
13 Q B -4.5598
14 K B -4.4018
15 A B -3.4076
16 N B -3.4660
17 V B -2.0914
18 L B 0.0000
19 Q B -2.9144
20 Q B -2.6306
21 A B 0.0000
22 L B 0.0000
23 A B -1.8766
24 E B -2.6993
25 H B -2.1790
26 Y B -1.4469
27 S B -1.4549
28 A B -1.4790
29 E B -2.3661
30 Q B -2.1075
31 A B -1.7005
32 S B -1.4702
33 A B -1.2899
34 L B 0.0000
35 S B -1.1243
36 K B -1.7113
37 L B -1.1206
38 S B -1.6417
39 P B -2.1238
40 E B -3.1467
41 E B -3.0343
42 Q B -2.8216
43 Q B -3.4938
44 K B -3.6518
45 L B -2.3417
46 G B 0.0000
47 Q B -3.1343
48 E B -3.1516
49 I B 0.0000
50 L B -1.5818
51 A B -1.5635
52 E B -2.6214
53 K B -1.9823
54 L B -0.1807
55 A B -0.5772
56 G B -1.0845
57 S B -0.6000
58 G B -0.2263
59 C B 0.4093
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018