Project name: query_structure

Status: done

Started: 2026-03-16 22:59:42
Settings
Chain sequence(s) A: CIAHYGKCDGIINQCCDPWLCTPPIIGFCL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)
Show buried residues

Minimal score value
-0.6974
Maximal score value
2.9424
Average score
0.8635
Total score value
25.9043

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A 0.5205
2 I A 0.0761
3 A A 0.0222
4 H A -0.0497
5 Y A 1.4587
6 G A 0.2219
7 K A -0.6974
8 C A 0.0000
9 D A -0.4409
10 G A 1.2783
11 I A 2.0539
12 I A 0.6604
13 N A -0.5259
14 Q A -0.6664
15 C A 0.0000
16 C A 0.3102
17 D A 0.0657
18 P A 0.7377
19 W A 1.8650
20 L A 1.9540
21 C A 1.3981
22 T A 1.3725
23 P A 1.2554
24 P A 1.5023
25 I A 2.9424
26 I A 2.5579
27 G A 1.5233
28 F A 2.0618
29 C A 0.0000
30 L A 2.4463
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018