Project name: Wei Li

Status: done

Started: 2026-03-29 04:09:52
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASGFTLSDYYMSWVRQAPGKGLEWMGIIYPGDSDTRYSPSFQGHVTISRDDSKNTLYLQMNSLRAEDTAVYYCTRWGAGKDVWGQGTTVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)
Show buried residues

Minimal score value
-2.5193
Maximal score value
1.2255
Average score
-0.6969
Total score value
-80.84

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.1200
2 V C -1.2529
3 Q C -1.2534
4 L C 0.0000
5 V C 1.0928
6 E C 0.2694
7 S C -0.4211
8 G C -0.8617
9 G C -0.3791
10 G C 0.3046
11 L C 1.2255
12 V C 0.0934
13 Q C -1.1888
14 P C -1.5157
15 G C -1.3144
16 G C -0.9498
17 S C -1.1840
18 L C -0.7376
19 R C -1.4865
20 L C 0.0000
21 S C -0.2523
22 C C 0.0000
23 A C -0.1765
24 A C 0.0000
25 S C -0.8980
26 G C -1.2231
27 F C -0.7281
28 T C -0.7027
29 L C 0.0000
30 S C -1.6410
31 D C -1.7988
32 Y C -0.4299
33 Y C -0.1088
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.5385
40 A C -1.1847
41 P C -1.1302
42 G C -1.4155
43 K C -2.0735
44 G C -0.9011
45 L C 0.5787
46 E C -0.1608
47 W C 0.3053
48 M C 0.0000
49 G C 0.0000
50 I C 0.0000
51 I C 0.0000
52 Y C -1.1027
53 P C -1.2660
54 G C -1.7135
55 D C -1.9710
56 S C -1.6901
57 D C -2.5193
58 T C -1.8695
59 R C -2.2821
60 Y C -1.1646
61 S C -0.8260
62 P C -0.9144
63 S C -0.8386
64 F C 0.0000
65 Q C -1.8420
66 G C -1.3621
67 H C -1.4239
68 V C 0.0000
69 T C -0.9342
70 I C 0.0000
71 S C -0.7451
72 R C 0.0000
73 D C -1.9122
74 D C -2.3091
75 S C -1.7172
76 K C -2.5022
77 N C -1.9422
78 T C 0.0000
79 L C 0.0000
80 Y C -0.3962
81 L C 0.0000
82 Q C -0.9988
83 M C 0.0000
84 N C -1.5380
85 S C -1.2193
86 L C 0.0000
87 R C -1.6093
88 A C -1.3655
89 E C -1.9759
90 D C 0.0000
91 T C -0.5560
92 A C 0.0000
93 V C 0.0758
94 Y C 0.0000
95 Y C 0.2488
96 C C 0.0000
97 T C 0.0000
98 R C 0.0000
99 W C -0.0212
100 G C -0.5345
101 A C -0.9072
102 G C -1.2787
103 K C -1.5747
104 D C -2.0581
105 V C -0.9984
106 W C -0.2056
107 G C -0.0728
108 Q C -0.8790
109 G C -0.3450
110 T C -0.2744
111 T C -0.1530
112 V C 0.0000
113 T C 0.0363
114 V C 0.0000
115 S C -0.6307
116 S C -0.6018
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018