Project name: f4b38cc1dcb9fb4

Chain sequence(s)	A: SVEDDIRFLEKVKEYLEEEAARLYAENPEEARKYRDTYLTEIDLLIARLRGDAAEAAALEAERAA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)

• Minimal score value: -3.9506
• Maximal score value: 0.0
• Average score: -2.0556
• Total score value: -133.6116

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-1.3520
2	V	A	-1.0002
3	E	A	-2.9432
4	D	A	-3.2256
5	D	A	-2.5091
6	I	A	-2.5045
7	R	A	-3.0851
8	F	A	-1.1517
9	L	A	0.0000
10	E	A	-2.7652
11	K	A	-2.7248
12	V	A	-1.3341
13	K	A	-2.6645
14	E	A	-3.2844
15	Y	A	-1.7832
16	L	A	-2.2202
17	E	A	-3.6700
18	E	A	-3.4557
19	E	A	-2.7136
20	A	A	0.0000
21	A	A	-2.2230
22	R	A	-2.7685
23	L	A	-2.2022
24	Y	A	-1.5762
25	A	A	-1.0044
26	E	A	-2.3823
27	N	A	-2.2948
28	P	A	-2.3178
29	E	A	-3.5981
30	E	A	-3.7093
31	A	A	0.0000
32	R	A	-3.7947
33	K	A	-3.9506
34	Y	A	-2.4681
35	R	A	-3.3110
36	D	A	-3.5993
37	T	A	-1.8158
38	Y	A	-0.8125
39	L	A	0.0000
40	T	A	-1.7755
41	E	A	-1.6814
42	I	A	-0.5777
43	D	A	-1.1459
44	L	A	-1.5001
45	L	A	-0.6941
46	I	A	0.0000
47	A	A	0.0000
48	R	A	-2.6559
49	L	A	-1.7026
50	R	A	-2.8416
51	G	A	-2.4740
52	D	A	-2.6758
53	A	A	-1.5987
54	A	A	-1.3383
55	E	A	-2.4701
56	A	A	-2.3059
57	A	A	-1.6013
58	A	A	-1.4287
59	L	A	-2.0310
60	E	A	-2.9221
61	A	A	-1.9871
62	E	A	-2.8688
63	R	A	-2.7689
64	A	A	-1.3379
65	A	A	-1.0125