Project name: query_structure

Status: done

Started: 2026-03-16 20:11:09
Settings
Chain sequence(s) A: GAIEVKDVTDTTALITWAKPWVDPPPLWGIELTYGIKDVPGDRTTIDLQQKHTAYSIGNLKPDTEYEVSLISFDPYGMRSKPAKETFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:28)
Show buried residues

Minimal score value
-3.1438
Maximal score value
1.3421
Average score
-0.937
Total score value
-83.3944

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -1.0156
2 A A -0.9699
3 I A 0.0000
4 E A -1.9486
5 V A -1.3675
6 K A -2.0822
7 D A -1.9759
8 V A -0.8621
9 T A -1.6013
10 D A -2.7537
11 T A -2.1136
12 T A -1.5140
13 A A 0.0000
14 L A -0.8267
15 I A 0.0000
16 T A -0.7238
17 W A 0.0000
18 A A -0.5466
19 K A -0.7588
20 P A -0.1035
21 W A 0.7016
22 V A 0.1048
23 D A -1.4225
24 P A -0.8502
25 P A -0.1171
26 P A 0.7106
27 L A 1.3397
28 W A 0.5291
29 G A -0.8577
30 I A 0.0000
31 E A -1.0582
32 L A 0.0000
33 T A -0.5701
34 Y A -0.6218
35 G A 0.0000
36 I A -1.4453
37 K A -2.0663
38 D A -2.1512
39 V A -0.9415
40 P A -1.0364
41 G A -1.0757
42 D A -1.4216
43 R A -1.0829
44 T A -0.4730
45 T A -0.5576
46 I A -0.7134
47 D A -1.9844
48 L A 0.0000
49 Q A -2.0971
50 Q A -1.5947
51 K A -2.2592
52 H A -1.6450
53 T A -0.8794
54 A A -0.4518
55 Y A 0.0843
56 S A -0.3408
57 I A 0.0000
58 G A -1.4406
59 N A -2.1347
60 L A 0.0000
61 K A -3.1438
62 P A -2.9996
63 D A -3.0643
64 T A 0.0000
65 E A -2.5512
66 Y A 0.0000
67 E A -1.5991
68 V A 0.0000
69 S A -1.2155
70 L A 0.0000
71 I A -1.0858
72 S A -0.8990
73 F A 0.0225
74 D A 0.0000
75 P A 0.9718
76 Y A 1.3421
77 G A 0.2092
78 M A 0.2518
79 R A -1.5926
80 S A -1.5617
81 K A -2.3877
82 P A -1.8191
83 A A -1.6915
84 K A -2.4678
85 E A -1.8751
86 T A -1.4188
87 F A 0.0000
88 T A -1.6493
89 T A -2.1860
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018