Project name: f4dcfde424c502f

Status: done

Started: 2026-07-15 15:27:50
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVFFYVITYGETGHGVGAFQAFKVPGSKSTATISGLKPGVDYTITVYARGYSKQGPYKPSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-2.6232
Maximal score value
2.1495
Average score
-0.4418
Total score value
-41.9744

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7949
2 S A 0.7219
3 S A 0.0000
4 V A 0.2569
5 P A 0.0000
6 T A -1.5058
7 K A -2.5730
8 L A 0.0000
9 E A -1.8977
10 V A 0.1517
11 V A 1.5733
12 A A 0.9309
13 A A 0.3210
14 T A -0.1573
15 P A -1.0801
16 T A -0.9679
17 S A -0.4990
18 L A 0.0000
19 L A 0.8287
20 I A 0.0000
21 S A -0.9513
22 W A 0.0000
23 D A -2.6144
24 A A -1.2236
25 P A 0.0391
26 A A 0.3569
27 V A 1.0350
28 T A 0.8191
29 V A 1.3083
30 F A 2.1495
31 F A 0.6934
32 Y A 0.0000
33 V A -0.2384
34 I A 0.0000
35 T A 0.0116
36 Y A -0.0005
37 G A 0.0000
38 E A -1.5565
39 T A -1.2847
40 G A -1.1212
41 H A -1.1882
42 G A -0.3461
43 V A 1.0027
44 G A 0.0565
45 A A -0.1831
46 F A 0.0405
47 Q A -0.5538
48 A A -0.3561
49 F A -0.3938
50 K A -1.0764
51 V A 0.0000
52 P A -0.4747
53 G A 0.0202
54 S A -0.6641
55 K A -2.0162
56 S A -1.4578
57 T A -0.7234
58 A A 0.0000
59 T A 0.1189
60 I A 0.0000
61 S A -0.6412
62 G A -1.0246
63 L A 0.0000
64 K A -2.3505
65 P A -1.6071
66 G A -1.3270
67 V A -1.4782
68 D A -2.3689
69 Y A 0.0000
70 T A -1.0878
71 I A 0.0000
72 T A 0.0487
73 V A 0.0000
74 Y A 0.0474
75 A A 0.0000
76 R A 0.4113
77 G A 0.0000
78 Y A 0.7083
79 S A -0.6476
80 K A -2.0473
81 Q A -1.8675
82 G A -1.0948
83 P A -0.6432
84 Y A -0.7418
85 K A -1.5718
86 P A -0.8371
87 S A -0.3787
88 P A -0.0802
89 I A 0.1738
90 S A -0.5294
91 I A -0.6924
92 N A -1.8070
93 Y A -1.4970
94 R A -2.6232
95 T A -1.5455
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018