Project name: cata

Status: done

Started: 2026-06-01 07:05:41
Settings
Chain sequence(s) A: PPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQW
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:09)
Show buried residues

Minimal score value
-2.1259
Maximal score value
2.0247
Average score
-0.4476
Total score value
-81.9074

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
54 P A -0.3015
55 P A -0.3865
56 G A -0.7473
57 N A -1.3589
58 Y A 0.0000
59 R A -0.7574
60 L A 0.0000
61 V A 0.0000
62 V A 0.0000
63 F A 0.0000
64 E A -0.3204
65 L A 0.2302
66 E A -1.6036
67 N A -1.4920
68 F A -0.1703
69 Q A -1.1697
70 G A -0.6353
71 R A -1.9013
72 R A -2.1259
73 A A -0.6673
74 E A -1.7732
75 F A -0.1360
76 S A -0.2820
77 G A -0.5289
78 E A -1.9137
79 C A 0.0000
80 S A -0.2654
81 N A -0.2868
82 L A 0.0000
83 A A -0.4850
84 D A -2.0995
85 R A -2.1248
86 G A -0.5493
87 F A 0.0000
88 D A -1.8374
89 R A -0.6167
90 V A 0.0000
91 R A -0.6310
92 S A 0.0000
93 I A 0.0000
94 I A 0.2046
95 V A 0.0000
96 S A -0.0581
97 A A -0.0998
98 G A -0.1001
99 P A 0.0000
100 W A 0.0000
101 V A 0.0000
102 A A 0.0000
103 F A 0.0000
104 E A -0.4288
105 Q A -0.7290
106 S A -0.3950
107 N A -1.1608
108 F A 0.0921
109 R A -1.7588
110 G A -0.5436
111 E A 0.0000
112 M A 0.0000
113 F A 0.0000
114 I A 0.0000
115 L A 0.0000
116 E A -0.9551
117 K A -1.8502
118 G A -0.8248
119 E A -1.7732
120 Y A -0.1799
121 P A -0.4785
122 R A -1.4594
123 W A -0.0673
124 N A -0.2403
125 T A -0.0806
126 W A 0.0000
127 S A 0.0000
128 S A -0.0475
129 S A 0.1997
130 Y A 0.9708
131 R A -1.6074
132 S A -0.4691
133 D A -0.8259
134 R A -1.5097
135 L A 0.0000
136 M A 0.0847
137 S A 0.0000
138 F A 0.0000
139 R A -0.7049
140 P A -0.1027
141 I A 0.0000
142 K A -1.6795
143 M A -0.3329
144 D A -0.6878
145 A A -0.2906
146 Q A -1.5292
147 E A -2.0448
148 H A 0.0000
149 K A -0.8613
150 I A 0.0000
151 S A -0.2252
152 L A 0.0000
153 F A 0.1202
154 E A -0.3402
155 G A -0.3370
156 A A -0.1437
157 N A -0.9169
158 F A 0.0174
159 K A -1.7100
160 G A -1.0173
161 N A -1.3714
162 T A -0.2303
163 I A -0.0285
164 E A -1.3338
165 I A 0.0000
166 Q A -1.3861
167 G A -1.0150
168 D A -1.8908
169 D A -0.7337
170 A A 0.0000
171 P A -0.2116
172 S A -0.0960
173 L A 0.0000
174 W A 1.1300
175 V A 2.0247
176 Y A 0.8123
177 G A -0.3601
178 F A 0.0000
179 S A -0.1589
180 D A -0.7076
181 R A -1.0669
182 V A 0.0000
183 G A 0.0000
184 S A 0.0000
185 V A 0.0000
186 K A -1.3017
187 V A 0.0000
188 S A -0.1840
189 S A -0.1481
190 G A 0.0000
191 T A -0.0842
192 W A 0.0000
193 V A 0.0000
194 G A 0.0000
195 Y A 0.0000
196 Q A -0.0188
197 Y A 0.5157
198 P A 0.0263
199 G A -0.1307
200 Y A -0.0230
201 R A -1.7058
202 G A 0.0000
203 Y A 0.0000
204 Q A 0.0000
205 Y A 0.0000
206 L A 0.0000
207 L A 0.0000
208 E A -0.6296
209 P A -0.3662
210 G A -0.5581
211 D A -1.9148
212 F A -0.3749
213 R A -1.9358
214 H A -0.5783
215 W A -0.1410
216 N A -1.6030
217 E A -2.0513
218 W A 0.0000
219 G A -0.3768
220 A A 0.0000
221 F A 1.7193
222 Q A -0.8436
223 P A -0.2968
224 Q A -0.3958
225 M A 0.0000
226 Q A 0.0000
227 S A 0.0000
228 L A 0.0000
229 R A -0.3922
230 R A -0.2849
231 L A 0.0000
232 R A -1.9316
233 D A -1.1297
234 K A -2.0065
235 Q A -1.2896
236 W A 0.9661
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018