Project name: f67d74a311f89a8

Chain sequence(s)	A: FVNQHLCGSHLVEALYLVCGERGFFYTKPTREAEDRGIVEQCCTSICSLYQLENYCN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:09)

• Minimal score value: -3.6062
• Maximal score value: 2.7114
• Average score: -0.6154
• Total score value: -35.0772

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
11	F	A	2.7114
12	V	A	2.5562
13	N	A	1.3644
14	Q	A	0.1161
15	H	A	-0.9313
16	L	A	-0.6073
17	C	A	-0.6737
18	G	A	-0.9116
19	S	A	-0.9328
20	H	A	-1.5438
21	L	A	0.0000
22	V	A	-0.0954
23	E	A	-1.4468
24	A	A	0.3226
25	L	A	0.0000
26	Y	A	0.1429
27	L	A	1.4536
28	V	A	1.0524
29	C	A	-0.2668
30	G	A	-1.0338
31	E	A	-2.3838
32	R	A	-2.3144
33	G	A	-0.7921
34	F	A	1.0456
35	F	A	0.3418
36	Y	A	0.3090
37	T	A	-0.1285
38	K	A	-1.1360
39	P	A	-1.4844
40	T	A	-2.3426
41	R	A	-3.5279
42	E	A	-3.6062
43	A	A	-2.5199
44	E	A	-2.8129
45	D	A	-3.2253
46	R	A	-3.2165
47	G	A	-2.1798
48	I	A	-0.9558
49	V	A	-0.8789
50	E	A	-1.8344
51	Q	A	-0.9180
52	C	A	0.0000
53	C	A	-0.4931
54	T	A	-0.3260
55	S	A	0.1311
56	I	A	1.5304
57	C	A	0.9949
58	S	A	0.7601
59	L	A	1.3458
60	Y	A	0.8922
61	Q	A	-0.3531
62	L	A	0.0000
63	E	A	-1.1575
64	N	A	-1.7523
65	Y	A	-1.1823
66	C	A	-0.7835
67	N	A	-1.3992