Project name: query_structure

Status: done

Started: 2026-03-16 23:50:55
Settings
Chain sequence(s) A: LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYILYWEFATAGEAIVLTVPGSERSYDLTGLKPGTEYMVLIRGVKGGTRSSPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)
Show buried residues

Minimal score value
-3.0763
Maximal score value
2.4091
Average score
-0.5983
Total score value
-53.2484

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 0.4301
2 P A -0.2245
3 A A -0.7157
4 P A 0.0000
5 K A -1.9569
6 N A -1.4814
7 L A -0.1555
8 V A 1.1366
9 V A 0.5896
10 S A -0.5951
11 R A -1.8161
12 V A -1.0505
13 T A -1.8644
14 E A -2.9701
15 D A -3.0285
16 S A -2.2128
17 A A 0.0000
18 R A -1.2008
19 L A 0.0000
20 S A -0.3775
21 W A 0.0000
22 T A -1.2730
23 A A -1.3968
24 P A -1.3820
25 D A -2.2687
26 A A -1.4372
27 A A -1.0566
28 F A 0.0000
29 D A -2.5961
30 S A -1.6450
31 F A 0.0000
32 Y A 0.4313
33 I A 0.0000
34 L A 1.3294
35 Y A 1.2368
36 W A 0.5036
37 E A -0.3051
38 F A 1.4675
39 A A 0.4707
40 T A -0.1429
41 A A -0.0952
42 G A -0.7500
43 E A -1.4448
44 A A 0.3616
45 I A 1.5642
46 V A 2.4091
47 L A 1.5430
48 T A 0.4957
49 V A 0.0000
50 P A -1.0779
51 G A 0.0000
52 S A -1.6000
53 E A -1.6504
54 R A -1.1356
55 S A -0.6269
56 Y A -0.7090
57 D A -1.6617
58 L A 0.0000
59 T A -1.5231
60 G A -1.5911
61 L A 0.0000
62 K A -3.0763
63 P A -2.5451
64 G A -1.7973
65 T A -1.5620
66 E A -0.5782
67 Y A 0.0000
68 M A 1.1514
69 V A 0.0000
70 L A 0.7443
71 I A 0.0000
72 R A -0.7536
73 G A 0.0000
74 V A -1.7008
75 K A -2.0948
76 G A -1.7413
77 G A -1.6355
78 T A -1.5973
79 R A -2.0969
80 S A 0.0000
81 S A -0.5234
82 P A -0.6601
83 L A -0.4474
84 S A 0.2787
85 A A 1.0912
86 I A 1.8287
87 F A 0.0000
88 T A -0.6015
89 T A -1.8815
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018