Project name: query_structure

Status: done

Started: 2026-03-16 23:10:11
Settings
Chain sequence(s) A: ESCVWIPCISSVVGCSCKSKVCYKNGTLPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:20)
Show buried residues

Minimal score value
-1.7031
Maximal score value
2.8973
Average score
0.3037
Total score value
9.4135

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.2116
2 S A 0.1735
3 C A 0.7939
4 V A 1.0148
5 W A 1.9534
6 I A 2.2850
7 P A 1.3178
8 C A 0.0000
9 I A 2.6606
10 S A 1.7572
11 S A 1.7284
12 V A 2.8973
13 V A 2.5376
14 G A 0.6456
15 C A 0.0000
16 S A -0.2522
17 C A -0.4059
18 K A -1.6631
19 S A -1.2042
20 K A -1.2840
21 V A -0.6957
22 C A 0.0000
23 Y A -0.7495
24 K A -0.9939
25 N A -1.7031
26 G A -0.9805
27 T A -0.2412
28 L A 0.5888
29 P A -0.1046
30 C A 0.0874
31 G A -0.5383
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018