Project name: hIL15(49-162) [mutate: VT3A, ER93A, IT111A, DK8A, IK67A, IR68A]

Chain sequence(s)	A: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	IT111A,IR68A,IK67A,VT3A,DK8A,ER93A
Energy difference between WT (input) and mutated protein (by FoldX)	-1.22368 kcal/mol

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:02:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:03:36)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:32)

• Minimal score value: -2.127
• Maximal score value: 1.3587
• Average score: -0.5062
• Total score value: -57.7039

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.2730
2	W	A	0.0000
3	T	A	-0.1746	mutated: VT3A
4	N	A	-0.6004
5	V	A	0.0000
6	I	A	0.2934
7	S	A	-0.1583
8	K	A	-0.4136	mutated: DK8A
9	L	A	0.0000
10	K	A	-2.0202
11	K	A	-1.4940
12	I	A	0.0000
13	E	A	-1.5367
14	D	A	-1.9107
15	L	A	0.0413
16	I	A	0.0000
17	Q	A	-1.2367
18	S	A	-0.3835
19	M	A	0.0301
20	H	A	-0.8965
21	I	A	-0.2455
22	D	A	-1.7412
23	A	A	-0.3262
24	T	A	-0.1333
25	L	A	0.0000
26	Y	A	-0.0226
27	T	A	0.0000
28	E	A	-0.2402
29	S	A	-0.5415
30	D	A	-1.7812
31	V	A	-0.2856
32	H	A	-0.9936
33	P	A	-0.4668
34	S	A	-0.2395
35	C	A	0.0190
36	K	A	-0.2097
37	V	A	0.1506
38	T	A	0.0141
39	A	A	0.0000
40	M	A	0.0000
41	K	A	-0.8956
42	C	A	0.0000
43	F	A	0.0000
44	L	A	0.0000
45	L	A	1.3587
46	E	A	0.0000
47	L	A	0.0000
48	Q	A	-0.2680
49	V	A	0.4669
50	I	A	0.0000
51	S	A	0.0000
52	L	A	1.2184
53	E	A	-1.5455
54	S	A	-0.4441
55	G	A	-0.5624
56	D	A	-0.5796
57	A	A	-0.1373
58	S	A	-0.1220
59	I	A	0.0000
60	H	A	-1.0706
61	D	A	-1.9251
62	T	A	0.0000
63	V	A	0.0000
64	E	A	-1.8672
65	N	A	-0.5908
66	L	A	0.0000
67	K	A	-0.8089	mutated: IK67A
68	R	A	-1.5341	mutated: IR68A
69	L	A	-0.0962
70	A	A	0.0000
71	N	A	-0.5851
72	N	A	-1.3427
73	S	A	-0.2589
74	L	A	0.0000
75	S	A	-0.2509
76	S	A	-0.4782
77	N	A	-1.3886
78	G	A	-0.8938
79	N	A	-1.2056
80	V	A	0.5578
81	T	A	0.0140
82	E	A	-0.3893
83	S	A	-0.3581
84	G	A	-0.4785
85	C	A	-0.2493
86	K	A	-2.0100
87	E	A	-2.1189
88	C	A	-0.5693
89	E	A	-2.1270
90	E	A	-2.1128
91	L	A	-0.4977
92	E	A	-2.0190
93	R	A	-1.6320	mutated: ER93A
94	K	A	-0.7616
95	N	A	-0.9070
96	I	A	-0.2592
97	K	A	-1.8040
98	E	A	-1.0860
99	F	A	0.0000
100	L	A	0.0000
101	Q	A	-0.7736
102	S	A	0.0000
103	F	A	0.0000
104	V	A	0.2191
105	H	A	-0.9185
106	I	A	0.0000
107	V	A	0.0000
108	Q	A	-0.7117
109	M	A	0.0474
110	F	A	0.0000
111	T	A	-0.3248	mutated: IT111A
112	N	A	-1.2889
113	T	A	-0.3357
114	S	A	-0.2255