Project name: 1-2

Status: done

Started: 2026-05-26 07:24:04
Settings
Chain sequence(s) A: KPYIDNYLHEKDNDNKIENYNKAEKKQSTSPKESPQIPKDKAKMAGYIEIPDAQIKEPVYPGPATPQQLNRGVSFAEGDESLNQQNISIAGHTFTDRPHYQFTNLKAAKKGSKVYFKVGNQTRKYKITKIHDVKPTEVKVLDEHPSKKNQLTLITCDDYNEQTGVWETRKIFVATQMN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:43)
Show buried residues

Minimal score value
-4.0341
Maximal score value
1.6952
Average score
-1.3133
Total score value
-233.771

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -1.3437
2 P A -0.6062
3 Y A 1.3099
4 I A 1.6952
5 D A 0.2564
6 N A 0.0000
7 Y A 1.2112
8 L A 0.7149
9 H A -0.9391
10 E A -1.9997
11 K A -2.4643
12 D A -3.1896
13 N A 0.0000
14 D A -3.3375
15 N A -3.8883
16 K A -3.4557
17 I A 0.0000
18 E A -3.8405
19 N A -3.5170
20 Y A -2.5558
21 N A -3.1062
22 K A -3.7577
23 A A -2.8917
24 E A -3.1740
25 K A -4.0341
26 K A -3.6907
27 Q A -3.5612
28 S A -2.9004
29 T A -1.6480
30 S A -1.6166
31 P A -1.8559
32 K A -3.1540
33 E A -3.3317
34 S A -2.3205
35 P A -1.9862
36 Q A -1.8452
37 I A -1.4979
38 P A -2.0287
39 K A -2.8384
40 D A -2.7636
41 K A -2.6141
42 A A -2.0400
43 K A -2.6274
44 M A -1.2608
45 A A 0.0000
46 G A 0.0000
47 Y A -0.3198
48 I A 0.0000
49 E A -1.6952
50 I A 0.0000
51 P A -1.8517
52 D A -2.8934
53 A A 0.0000
54 Q A -2.2571
55 I A 0.0000
56 K A -1.7867
57 E A 0.0000
58 P A 0.0000
59 V A 0.0000
60 Y A 0.0000
61 P A 0.0000
62 G A 0.0000
63 P A -1.5476
64 A A -0.8349
65 T A -1.0215
66 P A -1.3442
67 Q A -1.9917
68 Q A 0.0000
69 L A 0.0000
70 N A -2.1831
71 R A -2.1595
72 G A 0.0000
73 V A 0.0000
74 S A 0.0000
75 F A 0.0000
76 A A -1.0742
77 E A -2.3465
78 G A -2.1660
79 D A -2.5317
80 E A -1.9185
81 S A -1.5662
82 L A 0.0000
83 N A -1.7159
84 Q A -1.3651
85 Q A -2.0765
86 N A 0.0000
87 I A 0.0000
88 S A 0.0000
89 I A 0.0000
90 A A 0.0000
91 G A 0.0000
92 H A 0.0000
93 T A -0.5561
94 F A -0.2009
95 T A -0.8236
96 D A -2.0423
97 R A -1.2650
98 P A -0.8389
99 H A -1.1218
100 Y A -0.6508
101 Q A 0.0000
102 F A 0.0000
103 T A 0.0000
104 N A -1.3614
105 L A 0.0000
106 K A -2.2417
107 A A -1.8925
108 A A 0.0000
109 K A -3.4299
110 K A -3.0578
111 G A -2.2438
112 S A 0.0000
113 K A -1.9653
114 V A 0.0000
115 Y A -0.9510
116 F A 0.0000
117 K A -0.9888
118 V A 0.0000
119 G A -1.9289
120 N A -2.7688
121 Q A -1.6725
122 T A -1.0968
123 R A -1.1216
124 K A -1.8410
125 Y A 0.0000
126 K A -2.0118
127 I A 0.0000
128 T A -1.7990
129 K A -2.0334
130 I A -1.3510
131 H A -1.2869
132 D A -2.4488
133 V A 0.0000
134 K A -2.3938
135 P A -1.2551
136 T A -0.6428
137 E A -0.7294
138 V A 0.3505
139 K A -1.4687
140 V A -0.5426
141 L A -1.0217
142 D A -2.3964
143 E A -2.5442
144 H A -2.5079
145 P A -1.9378
146 S A -1.7826
147 K A -2.9479
148 K A -2.6894
149 N A -2.0262
150 Q A -1.4091
151 L A 0.0000
152 T A 0.0000
153 L A 0.0000
154 I A 0.0000
155 T A 0.0000
156 C A 0.0000
157 D A -1.4188
158 D A -2.4719
159 Y A -1.7035
160 N A -2.1903
161 E A -2.7517
162 Q A -2.2194
163 T A -1.4709
164 G A -1.4233
165 V A -1.0046
166 W A 0.0000
167 E A -2.3986
168 T A -2.0380
169 R A -2.1101
170 K A -1.7970
171 I A 0.0000
172 F A 0.0000
173 V A -0.6210
174 A A 0.0000
175 T A -1.6013
176 Q A -1.5481
177 M A -1.3658
178 N A -1.5577
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018