Project name: f7d79a81fdfc92b

Status: done

Started: 2026-06-22 16:06:36
Settings
Chain sequence(s) B: GELRAAMDEYKKRVKTMVELYGELVSEETRKKIEEKAKKMIAEMEARFKA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:50)
Show buried residues

Minimal score value
-4.9036
Maximal score value
0.9304
Average score
-2.3488
Total score value
-117.4395

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B -1.3803
2 E B -2.0169
3 L B -0.8865
4 R B -2.6539
5 A B -2.1891
6 A B -1.8080
7 M B 0.0000
8 D B -3.9893
9 E B -3.8382
10 Y B -2.9465
11 K B -3.7223
12 K B -4.3025
13 R B -3.9725
14 V B 0.0000
15 K B -3.1496
16 T B -1.7243
17 M B -0.8416
18 V B 0.0000
19 E B -1.6532
20 L B 0.8708
21 Y B 0.9304
22 G B 0.0000
23 E B -1.0263
24 L B 0.8628
25 V B -0.2174
26 S B -1.9866
27 E B -3.7271
28 E B -3.9890
29 T B -3.0479
30 R B -4.0071
31 K B -4.8813
32 K B -4.8176
33 I B -3.6910
34 E B -4.5897
35 E B -4.9036
36 K B -4.4894
37 A B 0.0000
38 K B -4.3158
39 K B -3.9778
40 M B -2.5297
41 I B -2.5533
42 A B -2.3997
43 E B -3.0881
44 M B -2.1574
45 E B -2.7146
46 A B -2.1396
47 R B -2.6755
48 F B -1.5094
49 K B -2.3335
50 A B -1.2604
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018