Project name: f7e4af9b498e181

Chain sequence(s)	A: TTVHQRTSEKRSCPGGSSRRYPSGASCDVSGGACACYVSNCRGVLCPTLNEIVAYTYEWHVDAW
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -2.6855
• Maximal score value: 2.0167
• Average score: -0.5932
• Total score value: -37.9638

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	A	0.3283
2	T	A	-0.0532
3	V	A	0.3434
4	H	A	-1.4733
5	Q	A	-2.0188
6	R	A	-2.6855
7	T	A	-1.1047
8	S	A	-1.1835
9	E	A	-1.5457
10	K	A	-2.3756
11	R	A	-2.2253
12	S	A	-1.2485
13	C	A	-0.6819
14	P	A	-0.5396
15	G	A	-0.6473
16	G	A	-0.8110
17	S	A	-1.0867
18	S	A	-1.4078
19	R	A	-2.5901
20	R	A	-1.9476
21	Y	A	-0.6683
22	P	A	0.0408
23	S	A	-0.3571
24	G	A	-0.8766
25	A	A	-0.8189
26	S	A	-1.1808
27	C	A	0.0000
28	D	A	-1.4260
29	V	A	0.6377
30	S	A	-0.1802
31	G	A	-0.4343
32	G	A	-0.4689
33	A	A	-0.1665
34	C	A	-0.6540
35	A	A	-0.8974
36	C	A	0.0000
37	Y	A	-0.7064
38	V	A	-0.7618
39	S	A	-1.4172
40	N	A	-1.5985
41	C	A	-0.8006
42	R	A	-1.5224
43	G	A	0.2522
44	V	A	2.0071
45	L	A	2.0167
46	C	A	0.0000
47	P	A	0.3968
48	T	A	-0.0199
49	L	A	-0.3060
50	N	A	-0.7300
51	E	A	-0.7966
52	I	A	0.9948
53	V	A	0.3628
54	A	A	0.2491
55	Y	A	0.7130
56	T	A	-0.1337
57	Y	A	0.0700
58	E	A	-1.7033
59	W	A	-0.6931
60	H	A	-1.0281
61	V	A	-0.1235
62	D	A	-1.2039
63	A	A	-0.0937
64	W	A	1.0173