Project name: query_structure

Status: done

Started: 2026-03-16 21:21:15
Settings
Chain sequence(s) A: MHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFSYGGCGGNQNRFESLEECKKMCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-3.3459
Maximal score value
1.5959
Average score
-1.281
Total score value
-74.2982

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.0502
2 H A -0.4933
3 S A 0.1039
4 F A 0.3872
5 C A 0.0000
6 A A 0.5476
7 F A 0.2215
8 K A -1.5294
9 A A -1.8973
10 D A -2.2555
11 D A -2.7203
12 G A -1.7232
13 P A -1.1728
14 C A -1.1532
15 R A -2.0870
16 A A -1.2243
17 A A -0.9668
18 H A -1.5160
19 P A -1.4148
20 R A -1.8584
21 W A -1.9219
22 F A -1.2912
23 F A 0.0000
24 N A -0.4578
25 I A 0.8479
26 F A 1.5959
27 T A -0.1893
28 R A -1.5312
29 Q A -2.0284
30 C A -1.9268
31 E A -1.7807
32 E A -2.3934
33 F A -1.4507
34 S A -1.5536
35 Y A 0.0000
36 G A 0.0000
37 G A -1.1539
38 C A -0.8878
39 G A -1.1853
40 G A -1.9061
41 N A -1.4851
42 Q A -1.5409
43 N A 0.0000
44 R A -1.9094
45 F A 0.0000
46 E A -2.5792
47 S A -2.2112
48 L A -2.0603
49 E A -3.0398
50 E A -2.7443
51 C A 0.0000
52 K A -3.3459
53 K A -3.2650
54 M A -1.5393
55 C A 0.0000
56 T A -2.7155
57 R A -2.9749
58 D A -2.9712
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018