Project name: f86bfefe9a51119

Status: done

Started: 2026-06-22 06:53:49
Settings
Chain sequence(s) A: MIEIICNDRLGKKIRIKCNTDDTIGDLKKLIAAQTGTRWNKIILKKWYTIFKDHISLGDYEIHDGMNLELYYQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)
Show buried residues

Minimal score value
-3.2146
Maximal score value
1.9749
Average score
-1.1784
Total score value
-86.02

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.4283
2 I A -1.4423
3 E A -2.5806
4 I A 0.0000
5 I A -2.1934
6 C A 0.0000
7 N A -2.3789
8 D A 0.0000
9 R A -1.8036
10 L A -0.2900
11 G A -1.6101
12 K A -2.5854
13 K A -3.2146
14 I A -2.2739
15 R A -2.9193
16 I A 0.0000
17 K A -2.4460
18 C A 0.0000
19 N A -2.0877
20 T A -2.3262
21 D A -2.5027
22 D A -1.8409
23 T A -1.8500
24 I A 0.0000
25 G A 0.0000
26 D A -1.4212
27 L A 0.0000
28 K A 0.0000
29 K A -1.7591
30 L A -0.5737
31 I A 0.0000
32 A A -1.6438
33 A A -1.0301
34 Q A -1.5189
35 T A -1.0520
36 G A -1.1733
37 T A -1.6989
38 R A -2.8301
39 W A -1.9463
40 N A -2.6073
41 K A -2.3492
42 I A 0.0000
43 I A -0.3551
44 L A 0.0000
45 K A -0.0571
46 K A 0.2623
47 W A 1.5488
48 Y A 1.9749
49 T A 1.1372
50 I A 0.8580
51 F A 0.0000
52 K A -1.5651
53 D A -1.8062
54 H A -1.6305
55 I A -1.4045
56 S A -2.0942
57 L A 0.0000
58 G A -2.5619
59 D A -2.5938
60 Y A -1.8089
61 E A -2.8285
62 I A 0.0000
63 H A -2.5812
64 D A -2.9739
65 G A -2.1153
66 M A -1.4884
67 N A -1.7884
68 L A 0.0000
69 E A -1.7097
70 L A 0.0000
71 Y A -0.2679
72 Y A -0.3385
73 Q A -1.4543
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018