Project name: F118E

Status: done

Started: 2026-07-09 20:01:44
Settings
Chain sequence(s) A: TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNMDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACEKEDSRKEGIAPEVAMVEAVIEKY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:31)
Show buried residues

Minimal score value
-3.8495
Maximal score value
0.6578
Average score
-1.2021
Total score value
-169.4936

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -1.0730
2 A A -1.5635
3 E A -2.2275
4 V A 0.0000
5 M A 0.0000
6 S A 0.0000
7 H A -0.7596
8 V A 0.0000
9 T A 0.0000
10 A A 0.0000
11 H A -0.5882
12 F A -0.6255
13 G A -1.3171
14 K A -2.4192
15 T A 0.0000
16 L A 0.0000
17 E A -3.5192
18 E A -3.5653
19 C A 0.0000
20 R A 0.0000
21 E A -3.5646
22 E A -3.1587
23 S A 0.0000
24 G A -1.8378
25 L A 0.0000
26 S A -0.5676
27 V A -0.1913
28 D A -1.2487
29 I A -0.6486
30 L A 0.0000
31 D A -2.2704
32 E A -2.2006
33 F A 0.0000
34 K A -1.4287
35 H A -1.9045
36 F A 0.0000
37 W A 0.0000
38 S A -2.1609
39 D A -3.1698
40 D A -3.0563
41 F A -1.8337
42 D A -1.9519
43 V A 0.0000
44 V A 0.4573
45 H A -0.8287
46 R A -1.8940
47 E A -1.5415
48 L A 0.0000
49 G A 0.0000
50 C A -0.8412
51 A A 0.0000
52 I A 0.0160
53 I A -0.2107
54 C A -0.8737
55 M A 0.0000
56 S A 0.0000
57 N A -1.8391
58 K A -1.9108
59 F A -0.8532
60 S A -1.1362
61 L A 0.0000
62 M A -1.6275
63 D A -2.3858
64 D A -3.0047
65 D A -2.9480
66 V A -1.7463
67 R A -1.9012
68 M A 0.0000
69 H A -0.9580
70 H A -0.7417
71 V A 0.6578
72 N A -0.5593
73 M A -0.7891
74 D A -1.7616
75 E A -2.1779
76 Y A -1.0258
77 I A 0.0000
78 K A -2.5664
79 S A -1.5112
80 F A -1.1539
81 P A -1.3325
82 N A -1.9135
83 G A 0.0000
84 Q A -2.1646
85 V A -0.4590
86 L A 0.0000
87 A A 0.0000
88 E A -2.7732
89 K A -2.2045
90 M A 0.0000
91 V A 0.0000
92 K A -2.7991
93 L A 0.0000
94 I A -1.4958
95 H A -2.2978
96 N A -2.7802
97 C A 0.0000
98 E A -2.6175
99 K A -3.3541
100 Q A -2.8481
101 F A -2.0271
102 D A -2.7857
103 T A -1.5299
104 E A -1.4683
105 T A -1.0677
106 D A -1.4782
107 D A -1.5288
108 C A -1.1228
109 T A -1.0995
110 R A 0.0000
111 V A 0.0000
112 V A 0.0000
113 K A -0.9136
114 V A -1.2651
115 A A 0.0000
116 A A -0.8122
117 C A -1.3171
118 E A -1.6444
119 K A 0.0000
120 E A -3.2034
121 D A -3.4343
122 S A 0.0000
123 R A -3.2234
124 K A -3.8495
125 E A -3.5564
126 G A -2.2226
127 I A 0.0000
128 A A -2.0534
129 P A 0.0000
130 E A -2.3062
131 V A -1.2147
132 A A -0.6148
133 M A -0.8271
134 V A 0.0000
135 E A -1.4250
136 A A -0.8163
137 V A -0.8120
138 I A -0.7312
139 E A -2.0426
140 K A -1.7553
141 Y A 0.2035
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018