Project name: GAP43

Status: done

Started: 2026-07-03 10:42:41
Settings
Chain sequence(s) A: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:08)
Show buried residues

Minimal score value
-4.6501
Maximal score value
2.5955
Average score
-1.8663
Total score value
-444.1817

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 2.2749
2 L A 2.5955
3 C A 2.0129
4 C A 1.4554
5 M A 0.6966
6 R A -1.9191
7 R A -3.1648
8 T A -2.0173
9 K A -3.0848
10 Q A -2.2709
11 V A -0.8419
12 E A -2.8598
13 K A -3.5485
14 N A -4.2131
15 D A -4.2636
16 D A -4.5918
17 D A -4.2990
18 Q A -3.5742
19 K A -3.6122
20 I A -1.7322
21 E A -2.9970
22 Q A -2.6248
23 D A -2.6256
24 G A -1.4651
25 I A -1.0836
26 K A -2.5404
27 P A -2.6026
28 E A -3.6994
29 D A -3.6784
30 K A -3.4127
31 A A -2.9638
32 H A -2.9966
33 K A -3.0134
34 A A -1.6573
35 A A -1.1886
36 T A -1.2536
37 K A -1.3054
38 I A 0.5674
39 Q A -0.8363
40 A A -0.7186
41 S A -0.0877
42 F A 0.5246
43 R A -1.3583
44 G A -1.0626
45 H A -1.3876
46 I A -0.9954
47 T A -1.6424
48 R A -2.7041
49 K A -3.1996
50 K A -2.7399
51 L A -1.5388
52 K A -3.8634
53 G A -4.1745
54 E A -4.1084
55 K A -4.1065
56 K A -4.0833
57 D A -3.7460
58 D A -2.9204
59 V A -0.5724
60 Q A -2.1001
61 A A -1.4549
62 A A -1.6312
63 E A -2.8125
64 A A -2.5740
65 E A -3.5910
66 A A -3.1805
67 N A -4.1129
68 K A -4.6501
69 K A -4.4575
70 D A -4.2140
71 E A -3.4074
72 A A -1.4383
73 P A -0.1611
74 V A 1.0300
75 A A -0.1568
76 D A -1.2576
77 G A -1.0652
78 V A -0.4641
79 E A -2.2457
80 K A -3.3443
81 K A -3.5318
82 G A -2.8999
83 E A -2.9131
84 G A -1.6729
85 T A -0.8418
86 T A -0.2273
87 T A -0.5076
88 A A -0.9748
89 E A -1.7632
90 A A -0.8485
91 A A -0.4207
92 P A -0.1944
93 A A -0.1930
94 T A -0.4067
95 G A -0.9807
96 S A -1.3647
97 K A -2.4014
98 P A -2.4926
99 D A -3.1737
100 E A -3.1443
101 P A -2.2436
102 G A -1.8052
103 K A -2.2169
104 A A -1.4961
105 G A -1.8039
106 E A -2.1578
107 T A -1.2106
108 P A -1.1608
109 S A -1.7904
110 E A -3.1981
111 E A -4.0297
112 K A -4.0148
113 K A -3.5928
114 G A -2.8767
115 E A -3.1229
116 G A -2.5599
117 D A -2.5004
118 A A -0.8715
119 A A -0.7419
120 T A -1.2974
121 E A -2.4100
122 Q A -2.0472
123 A A -0.8966
124 A A -0.5275
125 P A -0.7861
126 Q A -1.3382
127 A A -0.6922
128 P A -0.4908
129 A A -0.2024
130 S A -0.7447
131 S A -1.5480
132 E A -3.3199
133 E A -3.7265
134 K A -3.1343
135 A A -1.3724
136 G A -0.8503
137 S A -0.7740
138 A A -1.0208
139 E A -2.2849
140 T A -1.8660
141 E A -2.3588
142 S A -1.0926
143 A A -0.8394
144 T A -0.8849
145 K A -1.7373
146 A A -1.0738
147 S A -1.1169
148 T A -1.3307
149 D A -2.5861
150 N A -2.3825
151 S A -1.5396
152 P A -0.9851
153 S A -1.0420
154 S A -1.2003
155 K A -2.1832
156 A A -2.0832
157 E A -3.0369
158 D A -2.7091
159 A A -1.2984
160 P A -1.1250
161 A A -1.2193
162 K A -2.9912
163 E A -3.6020
164 E A -3.5814
165 P A -2.7882
166 K A -2.7981
167 Q A -2.4317
168 A A -1.3773
169 D A -1.2219
170 V A 0.8033
171 P A 0.4003
172 A A 0.7481
173 A A 1.0217
174 V A 1.7965
175 T A 0.8347
176 A A 0.4261
177 A A 0.1213
178 A A 0.1215
179 A A 0.0513
180 T A -0.1204
181 T A -0.2234
182 P A -0.2702
183 A A -0.6200
184 A A -1.2016
185 E A -2.6873
186 D A -2.6664
187 A A -1.1660
188 A A -0.6544
189 A A -0.7636
190 K A -1.6429
191 A A -0.9227
192 T A -0.6369
193 A A -0.5952
194 Q A -1.3809
195 P A -1.0398
196 P A -1.0898
197 T A -1.3573
198 E A -2.0554
199 T A -1.5940
200 G A -1.9938
201 E A -2.2460
202 S A -1.5815
203 S A -1.4006
204 Q A -1.9914
205 A A -2.0882
206 E A -3.2548
207 E A -3.2454
208 N A -2.0919
209 I A 0.3408
210 E A -1.2305
211 A A -0.3414
212 V A 0.3390
213 D A -1.9059
214 E A -2.7326
215 T A -2.2905
216 K A -2.5917
217 P A -2.2590
218 K A -3.0756
219 E A -2.7813
220 S A -1.8090
221 A A -1.8366
222 R A -3.1440
223 Q A -3.4297
224 D A -4.0688
225 E A -4.0948
226 G A -3.5428
227 K A -3.9971
228 E A -4.3340
229 E A -4.1108
230 E A -3.6896
231 P A -2.6449
232 E A -2.7530
233 A A -2.5710
234 D A -3.1673
235 Q A -3.2858
236 E A -3.3571
237 H A -2.1476
238 A A -1.0083
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018