Project name: query_structure

Status: done

Started: 2026-03-16 23:15:11
Settings
Chain sequence(s) A: EVQLVVVESSGGGLVVVQPGGSLLRLSCCAASGSISSVDVVMSWYRQQAPGKQRELLVAFITDRGRTNYKVVSVKGRFTISRDNSKNMMVVYLQMMNSSLKPEDTADDYLCCRAESRTSWSSPSSPLDVWGRGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:12)
Show buried residues

Minimal score value
-3.0272
Maximal score value
1.0218
Average score
-0.9237
Total score value
-112.6856

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1548
2 V A -1.4170
3 Q A -1.2747
4 L A 0.0000
5 V A 0.0128
6 E A 0.0000
7 S A -0.8889
8 G A -1.2209
9 G A -1.0248
10 G A -0.0556
11 L A 1.0218
12 V A 0.0285
13 Q A -1.3034
14 P A -1.5401
15 G A -1.3575
16 G A -0.8631
17 S A -1.0323
18 L A -0.8965
19 R A -2.1700
20 L A 0.0000
21 S A -0.5550
22 C A 0.0000
23 A A -0.3188
24 A A -0.6513
25 S A -0.9606
26 G A -1.1255
27 S A -0.9327
28 I A 0.0000
29 S A -1.2522
30 S A -0.9998
31 V A 0.0000
32 D A -1.5760
33 V A -1.1967
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 Y A -0.2521
38 R A 0.0000
39 Q A -2.2286
40 A A -2.0927
41 P A -1.5450
42 G A -1.8683
43 K A -3.0272
44 Q A -2.8846
45 R A -2.5173
46 E A -1.3446
47 L A -0.0415
48 V A 0.0000
49 A A 0.0000
50 F A 0.1002
51 I A 0.0000
52 T A -1.8400
53 D A -2.2968
54 R A -2.9454
55 G A -2.3146
56 R A -2.6148
57 T A -1.2705
58 N A -0.6921
59 Y A -0.1966
60 K A 0.0971
61 V A 0.8589
62 S A -0.1951
63 V A 0.0000
64 K A -1.5966
65 G A -1.2795
66 R A -1.3209
67 F A 0.0000
68 T A -0.8937
69 I A 0.0000
70 S A -0.6920
71 R A -1.2252
72 D A -1.6690
73 N A -1.8794
74 S A -1.6718
75 K A -2.3457
76 N A -1.7133
77 M A -1.0287
78 V A 0.0000
79 Y A 0.0000
80 L A 0.0000
81 Q A -1.3328
82 M A 0.0000
82A N A -1.3567
82B S A -1.2043
82C L A 0.0000
83 K A -2.2385
84 P A -1.9304
85 E A -2.3422
86 D A 0.0000
87 T A -1.1195
88 A A 0.0000
89 D A -1.8805
90 Y A 0.0000
91 L A 0.0000
92 C A 0.0000
93 R A -0.6523
94 A A 0.0000
95 E A -1.6784
96 S A -1.9211
97 R A -2.5056
98 T A -1.0912
99 S A -0.2940
100 W A 0.8904
100A S A 0.1790
100B S A -0.4445
100C P A -0.4680
100D S A -0.8553
100E P A -1.5295
100F L A -1.8621
101 D A -2.3044
102 V A -1.3587
103 W A -0.6495
104 G A -0.8042
105 R A -1.7795
106 G A -1.4608
107 T A -1.3862
108 Q A -1.5612
109 V A 0.0000
110 T A -0.4356
111 V A 0.0000
112 S A -0.7240
113 S A -0.4515
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018