Project name: query_structure

Status: done

Started: 2026-03-17 00:06:43
Settings
Chain sequence(s) A: MAVSDVPRKLEVVAATPTSLLISWDYYSYSYNYYRITYGETGGNSPVQEFTVPGYYYTATISGLKPGVDYTITVYAVTLYGPGYYYYYPGISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)
Show buried residues

Minimal score value
-2.8005
Maximal score value
2.2172
Average score
-0.1286
Total score value
-12.4785

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.2756
2 A A 0.8402
3 V A 1.0728
4 S A 0.2636
5 D A 0.4193
6 V A -0.0373
7 P A 0.0000
8 R A -2.0549
9 K A -2.8005
10 L A 0.0000
11 E A -1.9527
12 V A 0.1383
13 V A 1.5710
14 A A 0.9248
15 A A 0.3402
16 T A -0.1752
17 P A -1.1451
18 T A -1.0221
19 S A -0.5189
20 L A 0.0000
21 L A 0.8146
22 I A 0.0000
23 S A -0.5376
24 W A 0.0000
25 D A -1.8501
26 Y A 0.4611
27 Y A 0.8500
28 S A 0.6722
29 Y A 1.4089
30 S A 0.8240
31 Y A 0.0000
32 N A -0.3108
33 Y A 0.1235
34 Y A 0.0000
35 R A -0.3338
36 I A 0.0000
37 T A 0.0000
38 Y A -0.4648
39 G A -0.8106
40 E A -1.7456
41 T A -1.3641
42 G A -1.2759
43 G A -1.4772
44 N A -1.5560
45 S A -0.8893
46 P A -0.4089
47 V A 0.2545
48 Q A -1.2311
49 E A -1.8223
50 F A -0.7091
51 T A -0.1781
52 V A 0.6019
53 P A 0.5346
54 G A 0.0000
55 Y A 1.9934
56 Y A 1.8140
57 Y A 1.0740
58 T A 0.5971
59 A A 0.0000
60 T A 0.1523
61 I A 0.0000
62 S A -0.6526
63 G A -1.0383
64 L A 0.0000
65 K A -2.4605
66 P A -1.7985
67 G A -1.5768
68 V A -1.6376
69 D A -2.2877
70 Y A 0.0000
71 T A -0.8386
72 I A 0.0000
73 T A -0.3302
74 V A 0.0000
75 Y A 0.4051
76 A A 0.0000
77 V A 0.0000
78 T A 1.2559
79 L A 1.8066
80 Y A 2.1031
81 G A 1.1026
82 P A 0.3469
83 G A 0.5416
84 Y A 2.1577
85 Y A 2.2172
86 Y A 2.1780
87 Y A 1.6146
88 Y A 0.7517
89 P A 0.1508
90 G A 0.0357
91 I A -0.0639
92 S A -0.5954
93 I A -0.7076
94 N A -1.7658
95 Y A -1.5289
96 R A -2.6300
97 T A -1.5835
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018