Project name: f9e948d8c41fdab

Chain sequence(s)	A: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -3.2155
• Maximal score value: 1.5042
• Average score: -0.7223
• Total score value: -81.6164

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	F	A	0.7227
2	T	A	0.1856
3	V	A	0.0000
4	T	A	-1.0264
5	V	A	-1.2625
6	P	A	-1.2906
7	K	A	-2.3119
8	D	A	-2.2722
9	L	A	0.2023
10	Y	A	0.7229
11	V	A	1.5042
12	V	A	-0.0542
13	E	A	-1.6206
14	Y	A	-0.4261
15	G	A	-1.2965
16	S	A	-1.6339
17	N	A	-2.0561
18	M	A	0.0000
19	T	A	-0.5079
20	I	A	0.0000
21	E	A	-1.0953
22	C	A	0.0000
23	K	A	-0.9856
24	F	A	0.0000
25	P	A	-0.4974
26	V	A	-1.2472
27	E	A	-2.7157
28	K	A	-3.2155
29	Q	A	-2.3995
30	L	A	-1.2922
31	D	A	-1.6204
32	L	A	-0.5567
33	A	A	-0.5381
34	A	A	-0.2120
35	L	A	0.0000
36	I	A	0.4876
37	V	A	0.0000
38	Y	A	0.2509
39	W	A	0.0000
40	E	A	-1.9759
41	M	A	0.0000
42	E	A	-2.8777
43	D	A	-3.1049
44	K	A	-2.2123
45	N	A	-1.3189
46	I	A	0.0000
47	I	A	0.0000
48	Q	A	-0.5986
49	F	A	0.0000
50	V	A	-0.5757
51	H	A	-1.3981
52	G	A	-1.5243
53	E	A	-2.2827
54	E	A	-1.6647
55	D	A	-1.2173
56	L	A	-0.3987
57	K	A	-1.1995
58	V	A	-0.0612
59	Q	A	-1.0431
60	H	A	-1.3228
61	S	A	-1.3779
62	S	A	-1.3656
63	Y	A	0.0000
64	R	A	-2.6522
65	Q	A	-2.2120
66	R	A	0.0000
67	A	A	0.0000
68	R	A	-1.1092
69	L	A	0.0000
70	L	A	-1.3668
71	K	A	-2.5727
72	D	A	-2.4277
73	Q	A	-1.3584
74	L	A	0.0000
75	S	A	-0.7260
76	L	A	0.6126
77	G	A	0.0000
78	N	A	-0.6726
79	A	A	0.0000
80	A	A	0.0000
81	L	A	0.0000
82	Q	A	-0.6878
83	I	A	0.0000
84	T	A	-1.7698
85	D	A	-2.3084
86	V	A	0.0000
87	K	A	-1.0232
88	L	A	0.3120
89	Q	A	-0.6739
90	D	A	0.0000
91	A	A	-0.0156
92	G	A	-0.1010
93	V	A	-0.1061
94	Y	A	0.0000
95	R	A	-1.5031
96	C	A	0.0000
97	M	A	0.1662
98	I	A	0.0000
99	S	A	0.4603
100	Y	A	0.1490
101	G	A	-0.1982
102	G	A	-0.0638
103	A	A	0.3059
104	D	A	0.2618
105	Y	A	0.0685
106	K	A	-1.5288
107	R	A	-2.2937
108	I	A	0.0000
109	T	A	-0.2122
110	H	A	0.0000
111	H	A	0.1115
112	H	A	0.0000
113	H	A	-0.9028