Project name: fa269869ab7e64f

Status: done

Started: 2026-03-26 00:11:33
Settings
Chain sequence(s) A: TEVKVIIQPEKSVVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVSRQLIIYSFTTEHFPRVTNVATKRSNLDFSIRRISNNVTPEDAGTYYCVKFQQRGSPDTEEIQSGGGTEVYYVLA
B: YRYSAVYSSIHPSWCG
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:48)
Show buried residues

Minimal score value
-2.7989
Maximal score value
1.915
Average score
-0.4041
Total score value
-50.5151

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 T A -1.2048
7 E A -2.0533
8 V A 0.0000
9 K A -1.9516
10 V A -0.6857
11 I A -0.1728
12 Q A -0.8651
13 P A -1.1007
14 E A -1.9967
15 K A -2.4776
16 S A -1.3239
17 V A -0.2700
18 S A 0.4311
19 V A 0.0000
20 A A -0.2387
21 A A -0.8138
22 G A -1.7672
23 D A -2.3544
24 S A -1.5263
25 T A 0.0000
26 V A 0.3830
27 L A 0.0000
28 N A -0.4702
29 C A 0.0000
30 T A 0.0000
31 L A 0.0000
32 T A -0.8681
33 S A -0.1926
34 L A 1.1380
35 L A 1.9150
36 P A 1.1794
37 V A 1.3767
38 G A 0.0000
39 P A -0.5567
40 I A 0.0000
41 R A -0.2418
42 W A 0.0000
43 Y A 0.0000
44 R A -0.5483
45 G A -0.0707
46 V A 1.0823
49 S A -0.2896
50 R A -0.6672
51 Q A -1.0956
52 L A -0.2117
53 I A 0.0000
54 Y A 0.0000
55 S A 0.0000
56 F A 0.0000
57 T A -0.6747
58 T A -0.4133
59 E A -1.9122
60 H A -1.9885
61 F A -0.5704
62 P A -0.7520
63 R A -0.9551
64 V A 1.1038
65 T A 0.5522
66 N A 0.5243
67 V A 1.6435
70 A A -0.8056
71 T A -1.5809
72 K A -2.7196
73 R A -2.7989
74 S A -1.4352
75 N A -1.4739
76 L A -0.9753
77 D A -0.7153
78 F A 0.0000
79 S A 0.0000
80 I A 0.0000
81 R A -0.3639
82 I A 0.0000
83 S A -1.1907
84 N A -2.2556
85 V A 0.0000
86 T A -1.1970
87 P A -0.7830
88 E A -1.9140
89 D A 0.0000
90 A A -0.3863
91 G A -0.5728
92 T A -0.4536
93 Y A 0.0000
94 Y A 0.0882
95 C A 0.0000
96 V A 0.0000
97 K A 0.0000
98 F A 0.0000
99 Q A -1.1480
100 R A -2.0912
101 G A -1.3181
102 S A -0.9643
103 P A -1.2111
104 D A -1.7051
105 T A -1.4565
106 E A -1.7420
107 I A -0.7400
108 Q A -1.2649
109 S A -0.7249
110 G A 0.0000
111 G A -0.9275
112 G A 0.0000
113 T A 0.0000
114 E A -1.1484
115 V A 0.0000
116 Y A 1.0086
117 V A 0.5638
118 L A 1.1555
119 A A 0.6554
102 Y B 1.3288
103 R B 0.0335
104 Y B 0.3727
105 S B 0.4633
106 A B 0.4778
107 V B 0.6061
108 Y B 0.4813
109 S B 0.1504
110 I B 0.0000
111 H B 0.0000
112 P B -0.3357
113 S B 0.0922
114 W B 1.1632
115 C B 0.9858
116 G B 0.2096
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018