Project name: 06_rank

Status: done

Started: 2026-04-28 14:21:21
Settings
Chain sequence(s) B: SKEELEKEYRQLWYVVEPVWFFMRREGRPEEYYQYLTPHQREAVERLEEVKKQL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)
Show buried residues

Minimal score value
-4.3386
Maximal score value
0.9682
Average score
-1.9066
Total score value
-102.9559

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -2.2699
2 K B -3.6707
3 E B -4.1891
4 E B -4.0771
5 L B -3.8802
6 E B -4.0702
7 K B -4.3386
8 E B -3.4309
9 Y B -2.7856
10 R B -2.6566
11 Q B -2.0027
12 L B -1.5252
13 W B -0.3124
14 Y B 0.6895
15 V B 0.2459
16 V B 0.0000
17 E B 0.5899
18 P B 0.8664
19 V B 0.9682
20 W B 0.2046
21 F B 0.4991
22 F B 0.5981
23 M B -1.5308
24 R B -3.2261
25 R B -3.0870
26 E B -3.4192
27 G B -3.2388
28 R B -3.6009
29 P B -2.6508
30 E B -2.9510
31 E B -2.3467
32 Y B -0.5470
33 Y B -0.1460
34 Q B -0.8457
35 Y B 0.5054
36 L B 0.0000
37 T B -0.7546
38 P B -1.3353
39 H B -1.8821
40 Q B -1.4241
41 R B -2.2914
42 E B -3.4020
43 A B 0.0000
44 V B -2.4440
45 E B -3.8966
46 R B -3.9885
47 L B 0.0000
48 E B -3.8552
49 E B -4.0698
50 V B 0.0000
51 K B -3.5245
52 K B -3.5801
53 Q B -2.9143
54 L B -1.9613
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018