Project name: fb2479121af541f

Chain sequence(s)	A: TLTQPHSVSESPGKTVIISCTGSGGNIGDNYIQWYHQRPGSAPTTVIFDDDHRPSGVPEDRFSGSIDSSSNSASLTISGLQAEDEGDYYCQTYDDTDVIFGGGTRLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)

• Minimal score value: -3.1434
• Maximal score value: 1.8662
• Average score: -0.8447
• Total score value: -92.0683

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
3	T	A	-0.1657
4	L	A	0.0000
5	T	A	-0.2335
6	Q	A	0.0000
7	P	A	-0.9826
8	H	A	-1.7096
9	S	A	-1.4533
10	V	A	-0.5143
11	S	A	-0.2081
12	E	A	-0.4195
13	S	A	-0.4404
14	P	A	-0.9061
15	G	A	-1.5866
16	K	A	-2.0087
17	T	A	-0.8012
18	V	A	0.0000
19	I	A	1.4893
20	I	A	0.0000
21	S	A	0.3113
22	C	A	0.0000
23	T	A	-0.6035
24	G	A	-0.8829
25	S	A	-0.8305
26	G	A	-1.1713
27	G	A	-1.9856
28	N	A	-2.6931
29	I	A	0.0000
30	G	A	-2.0761
31	D	A	-2.8872
32	N	A	-1.8684
33	Y	A	-0.0765
34	I	A	0.0000
35	Q	A	-0.1187
36	W	A	0.0000
37	Y	A	0.2035
38	H	A	-0.9824
39	Q	A	-1.7285
40	R	A	-2.6813
41	P	A	-1.4892
42	G	A	-1.0882
43	S	A	-1.0314
44	A	A	-0.6125
45	P	A	-0.7323
46	T	A	-0.3997
47	T	A	-0.0095
48	V	A	0.0000
49	I	A	0.0000
50	F	A	-0.5098
51	D	A	-1.1599
52	D	A	-1.4495
53	D	A	-2.4542
54	H	A	-2.3925
55	R	A	-1.8830
56	P	A	-0.8073
57	S	A	-0.8867
58	G	A	-0.8804
59	V	A	-1.0534
60	P	A	-1.7784
61	E	A	-3.1434
62	D	A	-2.8731
63	R	A	-1.8384
64	F	A	0.0000
65	S	A	-1.4833
66	G	A	-1.0512
67	S	A	-1.1297
68	I	A	-0.6809
69	D	A	-1.4040
70	S	A	-1.5381
71	S	A	-0.9522
72	S	A	-0.9267
73	N	A	-1.3761
74	S	A	-0.9401
75	A	A	0.0000
76	S	A	-0.1399
77	L	A	0.0000
78	T	A	0.4627
79	I	A	0.0000
80	S	A	-1.1452
81	G	A	-1.4396
82	L	A	0.0000
83	Q	A	-1.7632
84	A	A	-1.2672
85	E	A	-2.4728
86	D	A	0.0000
87	E	A	-2.1823
88	G	A	0.0000
89	D	A	-1.9965
90	Y	A	0.0000
91	Y	A	-0.0193
92	C	A	0.0000
93	Q	A	0.0000
94	T	A	0.1642
95	Y	A	-0.7742
96	D	A	-3.0217
97	D	A	-2.9153
98	T	A	-1.9431
99	D	A	-1.8743
100	V	A	0.6820
101	I	A	0.9529
102	F	A	1.8662
103	G	A	0.5346
104	G	A	-0.5222
105	G	A	-0.8372
106	T	A	0.0000
107	R	A	-2.7018
108	L	A	0.0000
109	T	A	-0.7769
110	V	A	-0.1585
111	L	A	1.1869