Project name: fb617517a64423b

Status: done

Started: 2026-06-23 09:55:30
Settings
Chain sequence(s) A: MSHHHHHHSGPLPPPRNLYVIAYIPKEFDSNGDATSYEFYDVKVEKITQVSETKYKVEVKATSWENPEEIYNIELEVEIDPSASYREIKDKVREAFRKYFLSLQNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:46)
Show buried residues

Minimal score value
-3.948
Maximal score value
0.7136
Average score
-1.3156
Total score value
-139.4525

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5554
2 S A -0.6228
3 H A -1.7368
4 H A -2.3596
5 H A -2.7349
6 H A -2.7915
7 H A -2.7389
8 H A -2.3356
9 S A -1.8737
10 G A -0.9676
11 P A -0.8830
12 L A -0.4857
13 P A -0.4623
14 P A -1.3970
15 P A -1.9918
16 R A -2.8463
17 N A -2.2755
18 L A 0.0000
19 Y A -0.3824
20 V A 0.0000
21 I A 0.3830
22 A A 0.0000
23 Y A 0.5688
24 I A 0.0000
25 P A -0.6763
26 K A -1.8522
27 E A -2.1286
28 F A -0.8068
29 D A -1.7661
30 S A -1.3883
31 N A -2.1389
32 G A -1.9572
33 D A -2.4316
34 A A -1.3649
35 T A -0.9484
36 S A -0.6635
37 Y A 0.3396
38 E A -0.2331
39 F A 0.7136
40 Y A 0.0000
41 D A 0.2183
42 V A 0.0000
43 K A -1.7844
44 V A 0.0000
45 E A -2.8941
46 K A -2.9203
47 I A -1.5292
48 T A -0.8413
49 Q A -1.0057
50 V A 0.2362
51 S A -0.8570
52 E A -2.3724
53 T A -2.1472
54 K A -2.2591
55 Y A 0.0000
56 K A -2.1697
57 V A 0.0000
58 E A -3.1119
59 V A 0.0000
60 K A -1.6698
61 A A 0.0000
62 T A -0.7350
63 S A 0.0000
64 W A -0.6088
65 E A -2.3177
66 N A -2.5853
67 P A -1.9773
68 E A -2.6005
69 E A -1.8871
70 I A 0.3027
71 Y A -0.1829
72 N A -1.7515
73 I A 0.0000
74 E A -3.0311
75 L A 0.0000
76 E A -2.8931
77 V A 0.0000
78 E A -3.1554
79 I A 0.0000
80 D A -2.8911
81 P A -2.1616
82 S A -1.4591
83 A A -1.4303
84 S A -1.2162
85 Y A -0.7402
86 R A -2.8566
87 E A -3.3951
88 I A 0.0000
89 K A -2.7630
90 D A -3.9480
91 K A -3.7728
92 V A 0.0000
93 R A -2.6256
94 E A -3.3256
95 A A -2.8703
96 F A 0.0000
97 R A -1.6266
98 K A -2.0153
99 Y A -1.0908
100 F A 0.0000
101 L A -0.9761
102 S A -0.7958
103 L A -0.3254
104 Q A -1.4545
105 N A -1.6194
106 S A -0.8816
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018