Project name: obj1 [mutate: LG45C, WL47C, EM46C, PR41C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LG45C,EM46C,WL47C,PR41C
Energy difference between WT (input) and mutated protein (by FoldX)	5.05298 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:11)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)

• Minimal score value: -3.3173
• Maximal score value: 1.7519
• Average score: -0.6949
• Total score value: -83.3902

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0068
2	V	C	-0.9006
3	Q	C	-1.2218
4	L	C	0.0000
5	V	C	0.5875
6	E	C	0.2434
7	S	C	-0.4096
8	G	C	-0.8147
9	G	C	0.0115
10	G	C	0.9274
11	L	C	1.4457
12	V	C	-0.0349
13	Q	C	-1.3361
14	P	C	-1.4880
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9629
19	R	C	-2.1461
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2524
29	F	C	0.0000
30	R	C	-2.0330
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.1328
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-1.2063
40	A	C	-1.9959
41	R	C	-2.9174	mutated: PR41C
42	G	C	-2.4149
43	K	C	-2.9151
44	G	C	-1.9683
45	G	C	-0.8774	mutated: LG45C
46	M	C	0.0186	mutated: EM46C
47	L	C	0.9074	mutated: WL47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5397
53	G	C	-1.2461
54	S	C	-1.2292
55	G	C	-1.0822
56	G	C	-0.7347
57	S	C	-0.2413
58	T	C	0.3438
59	Y	C	0.9171
60	Y	C	-0.1101
61	A	C	-0.8085
62	D	C	-2.3002
63	S	C	-1.7025
64	V	C	0.0000
65	K	C	-2.3314
66	G	C	-1.6109
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6340
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3627
73	D	C	-1.9805
74	N	C	-2.1902
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6695
81	L	C	0.0000
82	Q	C	-1.2336
83	M	C	0.0000
84	N	C	-1.3326
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4694
88	A	C	-1.8849
89	E	C	-2.5231
90	D	C	0.0000
91	T	C	0.0000
92	A	C	0.0000
93	I	C	0.5573
94	Y	C	0.0000
95	Y	C	0.5072
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1758
101	D	C	-3.3173
102	G	C	-2.0536
103	F	C	-1.1322
104	N	C	-2.3963
105	K	C	-3.1646
106	G	C	-1.8863
107	F	C	-0.9355
108	D	C	-1.0681
109	Y	C	-0.1448
110	W	C	0.6965
111	G	C	0.0052
112	Q	C	-0.8412
113	G	C	0.1235
114	T	C	0.5876
115	L	C	1.7519
116	V	C	0.0000
117	T	C	0.3493
118	V	C	0.0000
119	S	C	-0.7725
120	S	C	-1.0588