Project name: RSVAseq35

Chain sequence(s)	A: QYQLVESGGGLVQPGGSLRLSCAASGFTFSNYAMGWFRQAPGQGLEAVAAISSGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDGSGWGRVYGYNYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)

• Minimal score value: -2.9447
• Maximal score value: 1.7724
• Average score: -0.5323
• Total score value: -64.9353

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.2217
2	Y	A	-0.3398
3	Q	A	-0.6843
4	L	A	0.0000
5	V	A	1.2237
6	E	A	0.0000
7	S	A	-0.1409
8	G	A	-0.6306
9	G	A	0.1479
10	G	A	0.6733
11	L	A	1.3923
12	V	A	-0.1130
13	Q	A	-1.4454
14	P	A	-1.8051
15	G	A	-1.5382
16	G	A	-1.0072
17	S	A	-1.2795
18	L	A	-0.8922
19	R	A	-2.1252
20	L	A	0.0000
21	S	A	-0.3474
22	C	A	0.0000
23	A	A	-0.1244
24	A	A	0.0000
25	S	A	-0.7694
26	G	A	-0.7748
27	F	A	-0.4591
28	T	A	-0.5829
29	F	A	0.0000
30	S	A	-1.2943
31	N	A	-1.4767
32	Y	A	-0.6090
33	A	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-0.4267
40	A	A	-0.8422
41	P	A	-0.9622
42	G	A	-1.2209
43	Q	A	-1.6773
44	G	A	-0.8914
45	L	A	0.2727
46	E	A	-0.4244
47	A	A	0.2580
48	V	A	0.0000
49	A	A	0.0000
50	A	A	-0.0135
51	I	A	0.0000
52	S	A	-0.7546
53	S	A	-0.9292
54	G	A	-1.1133
55	G	A	-0.9570
56	G	A	-0.8356
57	S	A	-0.5475
58	T	A	-0.0338
59	Y	A	0.2223
60	Y	A	-0.5875
61	A	A	0.0000
62	D	A	-2.4163
63	S	A	-1.8095
64	V	A	0.0000
65	K	A	-2.5421
66	G	A	-1.7599
67	R	A	-1.7151
68	F	A	0.0000
69	T	A	-0.7771
70	I	A	0.0000
71	S	A	-0.3974
72	R	A	-1.2205
73	D	A	-1.8831
74	N	A	-2.3162
75	S	A	-1.8350
76	K	A	-2.6075
77	N	A	-2.0943
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6139
81	L	A	0.0000
82	Q	A	-1.2468
83	M	A	0.0000
84	N	A	-1.5019
85	S	A	-1.4178
86	L	A	0.0000
87	R	A	-2.9447
88	A	A	-2.0248
89	E	A	-2.4547
90	D	A	0.0000
91	T	A	-0.4874
92	A	A	0.0000
93	V	A	0.9683
94	Y	A	0.0000
95	Y	A	0.5323
96	C	A	0.0000
97	A	A	0.0000
98	K	A	0.0000
99	D	A	0.0000
100	G	A	-0.8215
101	S	A	-0.7973
102	G	A	-0.5462
103	W	A	0.2231
104	G	A	-0.5985
105	R	A	-1.1921
106	V	A	0.3537
107	Y	A	0.5992
108	G	A	-0.2998
109	Y	A	-0.3466
110	N	A	-0.8510
111	Y	A	0.0943
112	W	A	0.3866
113	G	A	0.1563
114	Q	A	-0.7850
115	G	A	0.2037
116	T	A	0.7072
117	L	A	1.7724
118	V	A	0.0000
119	T	A	0.3249
120	V	A	0.0000
121	S	A	-0.7630
122	S	A	-0.5023