Project name: fc3dbdc0eda7f16

Chain sequence(s)	A: KDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)

• Minimal score value: -3.2666
• Maximal score value: 0.9191
• Average score: -0.8914
• Total score value: -44.5693

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.9294
2	D	A	-2.8872
3	G	A	-1.4149
4	P	A	-0.4560
5	F	A	0.9191
6	C	A	0.0000
7	M	A	0.1008
8	F	A	-0.0512
9	D	A	-1.2702
10	V	A	-0.2537
11	S	A	-0.6944
12	S	A	-0.2973
13	F	A	0.6532
14	N	A	-1.1781
15	Q	A	-1.6182
16	T	A	-1.2178
17	Q	A	-1.4583
18	A	A	-0.8352
19	W	A	-0.2477
20	K	A	-0.7550
21	Y	A	0.5638
22	G	A	0.4898
23	Y	A	-0.2314
24	P	A	-0.4501
25	F	A	0.0000
26	K	A	-3.1960
27	D	A	-2.6333
28	L	A	-1.4171
29	H	A	-1.7853
30	S	A	-1.9474
31	R	A	-3.2666
32	N	A	-1.9904
33	Y	A	0.0000
34	L	A	-1.3218
35	Y	A	-0.2125
36	D	A	-1.7386
37	R	A	-2.2060
38	S	A	-1.3720
39	L	A	-0.6171
40	W	A	-0.7126
41	N	A	-1.7092
42	S	A	-0.4372
43	V	A	-0.0043
44	C	A	0.0000
45	L	A	-0.3574
46	E	A	-1.4503
47	P	A	-0.6297
48	S	A	-0.0981
49	A	A	-0.0732
50	A	A	0.1262