Project name: obj1 [mutate: VA5C]

Status: done

Started: 2025-02-10 05:03:05
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VA5C
Energy difference between WT (input) and mutated protein (by FoldX) 0.547995 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:27)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Aggrescan3D profile | obj1 [mutate: VA5C] | Chain CE1V12S25G42G56T69N84G102Q112-4-2024ResidueScore
Minimal score value
-3.3333
Maximal score value
1.7594
Average score
-0.6934
Total score value
-83.2085

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

Show chain Show residues from to
residue index residue name chain Aggrescan3D score mutation
residue index
residue name
chain
Aggrescan3D score
mutation
1 E C -2.0237
2 V C -0.9529
3 Q C -1.5299
4 L C 0.0000
5 A C -0.6126 mutated: VA5C
6 E C -0.3822
7 S C -0.7066
8 G C -0.8276
9 G C 0.0032
10 G C 0.9229
11 L C 1.4406
12 V C -0.0385
13 Q C -1.3371
14 P C -1.4887
15 G C -1.4134
16 G C -0.9785
17 S C -1.2309
18 L C -0.9630
19 R C -2.1473
20 L C 0.0000
21 S C -0.7422
22 C C 0.0000
23 A C -0.6182
24 A C 0.0000
25 S C -0.3633
26 D C 0.0000
27 F C 1.5417
28 T C 0.2492
29 F C 0.0000
30 R C -2.0325
31 S C -0.8863
32 Y C -1.2160
33 E C -1.1454
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.2966
40 A C -0.9843
41 P C -1.2937
42 G C -1.4348
43 K C -2.1350
44 G C -1.0592
45 L C 0.3948
46 E C -0.3909
47 W C 0.3405
48 V C 0.0000
49 S C 0.0000
50 A C 0.0000
51 I C 0.0000
52 S C -0.5831
53 G C -1.2447
54 S C -1.2286
55 G C -1.0817
56 G C -0.7345
57 S C -0.3025
58 T C 0.1989
59 Y C 0.6077
60 Y C -0.3559
61 A C -1.1386
62 D C -2.3443
63 S C -1.7150
64 V C 0.0000
65 K C -2.3847
66 G C -1.6175
67 R C 0.0000
68 F C 0.0000
69 T C -0.6722
70 I C 0.0000
71 S C -0.5624
72 R C -1.3626
73 D C -1.9805
74 N C -2.1901
75 S C -1.7905
76 K C -2.3156
77 N C -1.6469
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6750
81 L C 0.0000
82 Q C -1.2337
83 M C 0.0000
84 N C -1.3327
85 S C -1.2322
86 L C 0.0000
87 R C -2.4721
88 A C -1.8894
89 E C -2.3444
90 D C 0.0000
91 T C -0.4216
92 A C 0.0000
93 I C 1.0770
94 Y C 0.0000
95 Y C 0.4828
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.1907
101 D C -3.3333
102 G C -2.0866
103 F C -1.2310
104 N C -2.4286
105 K C -3.1848
106 G C -1.9076
107 F C -0.9859
108 D C -1.1040
109 Y C -0.2190
110 W C 0.3926
111 G C -0.4606
112 Q C -1.1899
113 G C -0.1230
114 T C 0.4077
115 L C 1.7594
116 V C 0.0000
117 T C 0.3369
118 V C 0.0000
119 S C -0.7749
120 S C -1.0602
residue index residue name chain Aggrescan3D score
mutation
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018