Project name: fc6f71622783b21

Status: done

Started: 2026-06-26 08:41:31
Settings
Chain sequence(s) A: MSHHHHHHSGFPEKPLYIYPYDAAYNLEFYLKYALVENEKDSEYYYNQLKKILPLYPLSPEELEKELKTVLERLKDPSRRYYGIKKFVELMTLALSKAYLYKKEGNYEKAKEYLEVAEKYLKEVEELIPKIEEIDPWDAKYLKSYIERLKELLEKVKENS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:09)
Show buried residues

Minimal score value
-3.9809
Maximal score value
2.2765
Average score
-1.1148
Total score value
-178.3639

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5646
2 S A -0.6092
3 H A -1.7426
4 H A -2.3263
5 H A -2.7399
6 H A -2.7316
7 H A -2.5530
8 H A -1.8401
9 S A -0.8510
10 G A -0.4711
11 F A 0.5553
12 P A -0.7037
13 E A -2.1688
14 K A -1.9478
15 P A -0.2390
16 L A 1.4800
17 Y A 2.2765
18 I A 1.8516
19 Y A 1.6085
20 P A 1.0944
21 Y A 1.3337
22 D A -0.2607
23 A A 0.0000
24 A A 0.0000
25 Y A 0.7017
26 N A 0.3347
27 L A 0.0000
28 E A 0.0000
29 F A 1.3266
30 Y A 0.8293
31 L A 0.0000
32 K A 0.1666
33 Y A 0.1029
34 A A 0.0000
35 L A 0.0000
36 V A -1.2699
37 E A -2.8730
38 N A -3.0035
39 E A -2.9109
40 K A -3.2095
41 D A -2.5083
42 S A -2.2003
43 E A -2.4763
44 Y A -0.9010
45 Y A -0.5431
46 Y A -1.0456
47 N A -1.4297
48 Q A -1.1686
49 L A 0.0000
50 K A -1.5528
51 K A -2.0437
52 I A 0.0000
53 L A 0.0000
54 P A -0.1726
55 L A 1.0517
56 Y A 0.8401
57 P A 0.1086
58 L A -0.5192
59 S A -1.4411
60 P A 0.0000
61 E A -3.3174
62 E A -3.1646
63 L A 0.0000
64 E A -3.5179
65 K A -3.9809
66 E A -3.1711
67 L A 0.0000
68 K A -3.5916
69 T A -2.5888
70 V A 0.0000
71 L A 0.0000
72 E A -3.5491
73 R A -2.9701
74 L A 0.0000
75 K A -3.4570
76 D A -2.7746
77 P A -1.3714
78 S A -1.2417
79 R A -1.7899
80 R A 0.0000
81 Y A -0.0538
82 Y A 0.0430
83 G A 0.0000
84 I A 0.0000
85 K A -0.8738
86 K A -1.0738
87 F A 0.0000
88 V A -0.4360
89 E A -0.7454
90 L A 0.0000
91 M A 0.0000
92 T A 0.0000
93 L A 0.0000
94 A A 0.0000
95 L A 0.0000
96 S A 0.0000
97 K A 0.0000
98 A A 0.0000
99 Y A 0.0000
100 L A 0.0000
101 Y A -1.5071
102 K A -2.0668
103 K A -2.2065
104 E A -2.5722
105 G A -2.0458
106 N A -2.0677
107 Y A -1.7848
108 E A -2.8510
109 K A -2.4270
110 A A 0.0000
111 K A -3.5332
112 E A -3.4060
113 Y A 0.0000
114 L A 0.0000
115 E A -3.0855
116 V A 0.0000
117 A A 0.0000
118 E A -2.7917
119 K A -3.4312
120 Y A 0.0000
121 L A 0.0000
122 K A -3.8633
123 E A -3.6450
124 V A 0.0000
125 E A -2.9481
126 E A -3.2830
127 L A -2.4776
128 I A 0.0000
129 P A -2.0822
130 K A -2.7383
131 I A 0.0000
132 E A -2.1721
133 E A -2.1075
134 I A 0.1685
135 D A -0.8208
136 P A -0.9634
137 W A 0.3279
138 D A 0.0000
139 A A 0.0000
140 K A -1.7150
141 Y A -0.4068
142 L A 0.0000
143 K A -1.8878
144 S A -1.4240
145 Y A -1.3754
146 I A 0.0000
147 E A -2.9640
148 R A -2.2449
149 L A 0.0000
150 K A -3.1021
151 E A -3.3753
152 L A 0.0000
153 L A 0.0000
154 E A -3.8386
155 K A -3.2572
156 V A 0.0000
157 K A -3.2792
158 E A -3.3525
159 N A -2.4497
160 S A -1.4570
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018