Project name: pep1

Status: done

Started: 2026-07-27 21:28:47
Settings
Chain sequence(s) A: MSNWLAEDDLGSRVGATPLSPLGAVNAYENA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:08)
Show buried residues

Minimal score value
-2.09
Maximal score value
1.8984
Average score
-0.0909
Total score value
-2.8167

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8100
2 S A 0.2565
3 N A -0.1604
4 W A 1.2301
5 L A 1.3429
6 A A -0.5831
7 E A -2.0900
8 D A -2.0676
9 D A -2.0734
10 L A -0.4246
11 G A -1.2830
12 S A -1.1755
13 R A -1.6029
14 V A 0.6501
15 G A 0.0675
16 A A 0.2468
17 T A 0.1913
18 P A 0.3075
19 L A 1.2813
20 S A 0.6936
21 P A 0.8345
22 L A 1.8984
23 G A 1.1011
24 A A 0.9613
25 V A 1.3265
26 N A -0.5441
27 A A -0.1452
28 Y A 0.3754
29 E A -1.7627
30 N A -1.6849
31 A A -0.7941
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018