Project name: fd510e430e0141c

Chain sequence(s)	A: NFMLNQPHSVSESPGKTVTISCTRSSGNIDSNYVQWYQQRPGSAPITVIYEDNQRPSGVPDRFAGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTEC
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:58)

• Minimal score value: -3.2179
• Maximal score value: 1.6522
• Average score: -0.897
• Total score value: -192.8633

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.2342
2	F	A	0.0000
3	M	A	0.1896
4	L	A	0.0000
5	N	A	-1.1805
6	Q	A	0.0000
7	P	A	-1.2754
8	H	A	-1.7088
9	S	A	-1.1737
11	V	A	-0.8285
12	S	A	-1.0288
13	E	A	-1.2917
14	S	A	-1.2828
15	P	A	-1.7899
16	G	A	-1.8515
17	K	A	-2.2027
18	T	A	-1.1630
19	V	A	0.0000
20	T	A	-0.1431
21	I	A	0.0000
22	S	A	-0.4857
23	C	A	0.0000
24	T	A	-0.9978
25	R	A	0.0000
26	S	A	-0.7541
27	S	A	-0.8882
28	G	A	-1.5946
29	N	A	-2.5416
30	I	A	0.0000
35	D	A	-2.1651
36	S	A	-1.1231
37	N	A	-0.6063
38	Y	A	0.2407
39	V	A	0.0000
40	Q	A	0.0000
41	W	A	0.0000
42	Y	A	0.7319
43	Q	A	-0.2532
44	Q	A	-0.9441
45	R	A	-2.0110
46	P	A	-1.2972
47	G	A	-1.0260
48	S	A	-0.7329
49	A	A	-0.2061
50	P	A	0.0856
51	I	A	1.0809
52	T	A	0.5996
53	V	A	0.0000
54	I	A	0.0000
55	Y	A	-1.0036
56	E	A	-1.8760
57	D	A	-1.7065
65	N	A	-2.3028
66	Q	A	-2.3849
67	R	A	-2.4007
68	P	A	-0.8700
69	S	A	-0.9685
70	G	A	-0.8994
71	V	A	-0.8997
72	P	A	-1.4080
74	D	A	-2.3066
75	R	A	-1.5166
76	F	A	0.0000
77	A	A	-1.2817
78	G	A	-1.1852
79	S	A	-1.2743
80	I	A	-1.3211
81	D	A	-2.4658
82	R	A	-3.1905
83	S	A	-1.7831
84	S	A	-1.4899
85	N	A	-2.0959
86	S	A	0.0000
87	A	A	0.0000
88	S	A	-0.4941
89	L	A	0.0000
90	T	A	-0.1999
91	I	A	0.0000
92	S	A	-1.3144
93	G	A	-1.6295
94	L	A	0.0000
95	K	A	-2.8437
96	T	A	-2.0652
97	E	A	-2.7832
98	D	A	0.0000
99	E	A	-2.1846
100	A	A	0.0000
101	D	A	0.0000
102	Y	A	0.0000
103	Y	A	0.1235
104	C	A	0.0000
105	Q	A	0.0000
106	S	A	0.0000
107	Y	A	0.2976
108	D	A	-1.1281
109	A	A	-1.2736
114	R	A	-2.0610
115	N	A	-1.3923
116	V	A	0.9890
117	V	A	0.0000
118	F	A	1.6522
119	G	A	0.0000
120	G	A	-0.5999
121	G	A	-0.6656
122	T	A	0.0000
123	R	A	-1.5403
124	L	A	0.0000
125	T	A	0.0000
126	V	A	0.0000
127	L	A	-0.8127
128	G	A	-0.8864
129	Q	A	-1.2168
130	P	A	-1.3411
131	K	A	-2.1454
132	A	A	-1.3569
133	A	A	-0.7399
134	P	A	-0.4285
135	S	A	-0.2713
136	V	A	0.0000
137	T	A	0.0962
138	L	A	0.0000
139	F	A	1.1070
140	P	A	0.3513
141	P	A	-0.5953
142	S	A	-1.2950
143	S	A	-1.7316
144	E	A	-3.1136
145	E	A	-3.0878
146	L	A	-2.3007
147	Q	A	-2.6619
148	A	A	-2.3078
149	N	A	-2.8850
150	K	A	-3.0445
151	A	A	0.0000
152	T	A	-0.4473
153	L	A	0.0000
154	V	A	1.0467
155	C	A	0.0000
156	L	A	0.9291
157	I	A	0.0000
158	S	A	-0.7176
159	D	A	-1.8456
160	F	A	0.0000
161	Y	A	0.0000
162	P	A	0.0000
163	G	A	-0.8060
164	A	A	-0.4252
165	V	A	-0.2307
166	T	A	-0.1973
167	V	A	0.0316
168	A	A	-0.4502
169	W	A	0.0000
170	K	A	-0.9416
171	A	A	-1.2317
172	D	A	-1.4058
173	S	A	-0.9414
174	S	A	-0.8364
175	P	A	-0.9028
176	V	A	-0.9021
177	K	A	-1.8058
178	A	A	-0.9903
179	G	A	-0.8462
180	V	A	-0.6208
181	E	A	-1.4786
182	T	A	-0.4277
183	T	A	-0.4481
184	T	A	-0.3776
185	P	A	-0.4686
186	S	A	-1.0827
187	K	A	-2.3546
188	Q	A	-2.6317
189	S	A	-2.0539
190	N	A	-2.6894
191	N	A	-2.9404
192	K	A	-2.7400
193	Y	A	-1.6021
194	A	A	-0.8411
195	A	A	0.0000
196	S	A	0.1864
197	S	A	0.0000
198	Y	A	0.4821
199	L	A	0.0000
200	S	A	-0.6064
201	L	A	0.0000
202	T	A	-2.0434
203	P	A	-2.5935
204	E	A	-3.2179
205	Q	A	-2.4986
206	W	A	0.0000
207	K	A	-3.1106
208	S	A	-2.4087
209	H	A	-2.3509
210	K	A	-2.3958
211	S	A	-1.4643
212	Y	A	0.0000
213	S	A	0.0000
214	C	A	0.0000
215	Q	A	-0.9025
216	V	A	0.0000
217	T	A	-0.5775
218	H	A	0.0000
219	E	A	-1.7697
220	G	A	-1.2589
221	S	A	-0.6258
222	T	A	-0.4611
223	V	A	-0.3348
224	E	A	-1.8712
225	K	A	-1.3897
226	T	A	-0.7703
227	V	A	-0.1474
228	A	A	-0.8186
229	P	A	-1.2724
230	T	A	-0.9808
231	E	A	-1.5173
232	C	A	-0.2049