Project name: query_structure

Status: done

Started: 2026-03-17 00:13:20
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIHYAEYPDFGEAIVLTVPGSERSYDLTGLKPGTEYIVDIWGVKGGLGSWPLSAIFTTGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:35)
Show buried residues

Minimal score value
-3.1131
Maximal score value
1.9042
Average score
-0.5352
Total score value
-49.2377

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.4141
2 L A 0.8717
3 P A 0.1663
4 A A 0.0891
5 P A 0.0000
6 K A -1.9928
7 N A -1.3331
8 L A -0.1281
9 V A 1.1717
10 V A 0.6086
11 S A -0.6351
12 R A -1.8557
13 V A -1.1369
14 T A -1.9609
15 E A -3.1131
16 D A -3.0395
17 S A -2.2072
18 A A 0.0000
19 R A -1.2196
20 L A 0.0000
21 S A -0.3699
22 W A 0.0000
23 T A -1.2850
24 A A -1.4098
25 P A -1.3351
26 D A -2.2182
27 A A -1.4650
28 A A -1.2008
29 F A 0.0000
30 D A -2.5353
31 S A -1.4400
32 F A 0.0000
33 N A 0.2251
34 I A 0.0000
35 H A 0.7232
36 Y A 0.0000
37 A A 0.0000
38 E A -0.6427
39 Y A 0.1546
40 P A -0.2837
41 D A -1.3624
42 F A 0.4171
43 G A -0.8040
44 E A -1.4081
45 A A 0.2018
46 I A 1.0740
47 V A 1.9042
48 L A 1.2105
49 T A 0.3435
50 V A 0.0000
51 P A -1.1409
52 G A 0.0000
53 S A -1.5988
54 E A -1.6782
55 R A -0.9519
56 S A -0.6433
57 Y A -0.7103
58 D A -1.6732
59 L A 0.0000
60 T A -1.4924
61 G A -1.5608
62 L A 0.0000
63 K A -3.0602
64 P A -2.6935
65 G A -1.9776
66 T A -1.7183
67 E A -0.7990
68 Y A 0.0000
69 I A 0.8939
70 V A 0.0000
71 D A 0.2942
72 I A 0.0000
73 W A 0.2384
74 G A 0.0000
75 V A -0.4999
76 K A -1.5480
77 G A -1.2938
78 G A -0.8784
79 L A 0.1213
80 G A 0.4954
81 S A 0.0000
82 W A 1.3806
83 P A 0.2385
84 L A -0.0496
85 S A 0.4543
86 A A 1.0531
87 I A 1.6631
88 F A 0.0000
89 T A -0.6605
90 T A 0.0000
91 G A -1.8489
92 G A -1.7865
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018