Project name: fde0aff7b615f32

Status: done

Started: 2026-07-01 15:23:06
Settings
Chain sequence(s) B: TSTRFRYQSLDSSGNVLSSQDHTIVGPPAIANVSISRVSPSTVQVTLTLL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:17)
Show buried residues

Minimal score value
-3.7512
Maximal score value
1.9766
Average score
-0.0231
Total score value
-1.1574

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T B 0.1974
2 S B 0.0909
3 T B -0.6187
4 R B -2.3629
5 F B -2.2434
6 R B -3.2905
7 Y B -1.6624
8 Q B -0.9106
9 S B 0.3274
10 L B 1.1665
11 D B -0.0540
12 S B -0.5238
13 S B -0.6845
14 G B -0.5158
15 N B -0.3661
16 V B 1.4665
17 L B 1.8057
18 S B 0.4804
19 S B -1.2023
20 Q B -2.9210
21 D B -3.7512
22 H B -2.4730
23 T B -1.1834
24 I B 0.3767
25 V B 1.2822
26 G B 0.6171
27 P B 0.4837
28 P B 0.3364
29 A B 0.9710
30 I B 1.5568
31 A B 0.8958
32 N B 0.0542
33 V B 1.4706
34 S B 1.0126
35 I B 1.8513
36 S B 0.1728
37 R B -0.7223
38 V B 0.8834
39 S B -0.0107
40 P B -0.3069
41 S B -0.2377
42 T B -0.1377
43 V B 0.2706
44 Q B -0.2093
45 V B 0.8825
46 T B 0.6608
47 L B 1.1663
48 T B 0.9806
49 L B 1.7940
50 L B 1.9766
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018