Project name: fe4f949e1232ddb

Status: done

Started: 2024-07-05 10:35:30
Settings
Chain sequence(s) A: TCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:52)
Show buried residues

Minimal score value
-3.5455
Maximal score value
0.9356
Average score
-1.3992
Total score value
-337.1963

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
39 T A -1.7846
40 C A 0.0000
41 E A -3.3014
42 E A -2.7656
43 C A -1.3917
44 G A -2.0258
45 K A -2.3891
46 P A -1.4064
47 I A -1.6329
48 G A -1.2428
49 C A -0.7590
50 D A -2.0107
51 C A -2.0905
52 K A -3.1548
53 D A -3.0536
54 L A -1.8036
55 S A -1.8597
56 Y A -1.3415
57 K A -2.6278
58 D A -2.9177
59 R A -3.0639
60 H A -2.8014
61 W A 0.0000
62 H A -2.4325
63 E A -2.2436
64 A A -1.3245
65 C A -1.3050
66 F A 0.0000
67 H A -1.6999
68 C A 0.0000
69 S A -1.8793
70 Q A -1.9381
71 C A -1.5706
72 R A -2.6231
73 N A -2.2398
74 S A -1.7524
75 L A 0.0000
76 V A -1.4864
77 D A -2.2464
78 K A -1.9966
79 P A -0.9214
80 F A -0.2890
81 A A -0.5004
82 A A -1.1210
83 K A -2.2130
84 E A -3.2337
85 D A -3.5455
86 Q A -2.7676
87 L A 0.0000
88 L A 0.0000
89 C A -1.2331
90 T A -0.9092
91 D A -2.1346
92 C A -1.4466
93 Y A -0.9989
94 S A 0.0000
95 N A -2.5385
96 E A -2.0660
97 Y A -0.2205
98 S A -0.6966
99 S A -1.4453
100 K A -2.6228
101 C A 0.0000
102 Q A -2.6902
103 E A -2.6521
104 C A -2.2005
105 K A -3.3926
106 K A -3.2509
107 T A -2.3106
108 I A 0.0000
109 M A -0.8439
110 P A -0.6234
111 G A -1.0376
112 T A -1.5585
113 R A -2.9428
114 K A -2.7450
115 M A -2.0188
116 E A -2.7417
117 Y A -1.4901
118 K A -2.1599
119 G A -1.6946
120 S A -1.7006
121 S A 0.0000
122 W A 0.0000
123 H A -2.5660
124 E A -2.5575
125 T A -1.5532
126 C A -1.2683
127 F A 0.0000
128 I A -1.2112
129 C A 0.0000
130 H A -1.8069
131 R A -2.1371
132 C A -1.3268
133 Q A -2.0454
134 Q A -1.8823
135 P A -1.4008
136 I A 0.0000
137 G A -1.2529
138 T A -1.0938
139 K A -1.6826
140 S A -0.6417
141 F A 0.2271
142 I A 0.3573
143 P A -0.9901
144 K A -2.2955
145 D A -3.0698
146 N A -2.7583
147 Q A -2.3569
148 N A 0.0000
149 F A -0.4274
150 C A 0.0000
151 V A -0.1351
152 P A -0.7846
153 C A -1.0954
154 Y A -1.3231
155 E A -1.7413
156 K A -2.6405
157 Q A -2.6239
158 H A -2.1182
159 A A -1.6029
160 M A -0.9920
161 Q A -2.5180
162 C A 0.0000
163 V A -1.2829
164 Q A -2.0305
165 C A -1.8482
166 K A -2.9706
167 K A -3.0504
168 P A -2.3080
169 I A 0.0000
170 T A -1.1748
171 T A -0.5664
172 G A -0.7434
173 G A -0.9223
174 V A -0.7372
175 T A -1.1745
176 Y A -1.4203
177 R A -3.0516
178 E A -2.9467
179 Q A -2.1517
180 P A -1.3891
181 W A -1.4560
182 H A -1.9904
183 K A -2.4043
184 E A -3.1139
185 C A -1.8768
186 F A 0.0000
187 V A -1.5762
188 C A 0.0000
189 T A -0.0487
190 A A -0.0026
191 C A -0.9620
192 R A -2.4818
193 K A -2.5236
194 Q A -2.8809
195 L A 0.0000
196 S A -1.7527
197 G A -1.5497
198 Q A -2.1930
199 R A -2.2342
200 F A -0.8298
201 T A -0.3916
202 A A -0.8584
203 R A -2.2979
204 D A -2.8161
205 D A -2.4268
206 F A 0.0260
207 A A 0.0000
208 Y A 0.0000
209 C A 0.0000
210 L A -0.5724
211 N A -1.2391
212 C A -0.2233
213 F A 0.0819
214 C A -0.5614
215 D A -1.3990
216 L A 0.9356
217 Y A 0.6965
218 A A -0.5671
219 K A -1.5234
220 K A -1.8846
221 C A 0.0000
222 A A -1.3310
223 G A -1.4502
224 C A -0.7066
225 T A -1.0859
226 N A -1.9763
227 P A -1.5622
228 I A 0.0000
229 S A -0.9297
230 G A -0.6392
231 L A 0.2371
232 G A -0.6147
233 G A -0.9825
234 T A -1.1721
235 K A -1.8043
236 Y A -0.6240
237 I A -0.1195
238 S A -0.8291
239 F A -0.8906
240 E A -2.5864
241 E A -2.8216
242 R A -2.0758
243 Q A -1.2438
244 W A 0.0000
245 H A -1.4885
246 N A -1.7025
247 D A -2.0604
248 C A -1.1080
249 F A 0.0000
250 N A -1.2731
251 C A 0.0000
252 K A -2.8532
253 K A -2.5479
254 C A -0.9910
255 S A -0.7756
256 L A -0.1123
257 S A -0.7544
258 L A 0.0000
259 V A -0.5444
260 G A -1.0800
261 R A -1.9589
262 G A -1.0845
263 F A -0.2611
264 L A -0.0674
265 T A -0.8759
266 E A -1.9830
267 R A -3.2616
268 D A -3.4686
269 D A -3.0392
270 I A 0.0000
271 L A 0.0000
272 C A 0.0000
273 P A -1.4988
274 D A -2.5878
275 C A -1.7274
276 G A 0.0000
277 K A -2.4655
278 D A -1.8836
279 I A 0.5683
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018