Project name: query_structure

Status: done

Started: 2026-03-16 20:33:27
Settings
Chain sequence(s) A: LPAPKNLVVSRVTEDSARLSWTAPDAAFDSFAIFYHEFANPGEAIDLPVPGSERSYDLTGLKPGTEYDVRIYGVKGGTASIPLDAEFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:57)
Show buried residues

Minimal score value
-2.9154
Maximal score value
2.0335
Average score
-0.8987
Total score value
-79.9802

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.1330
2 P A 0.3624
3 A A 0.3607
4 P A 0.0000
5 K A -2.0136
6 N A -1.5315
7 L A -0.5335
8 V A 0.6484
9 V A 0.0890
10 S A -0.5677
11 R A -1.7876
12 V A -0.9191
13 T A -1.6985
14 E A -2.7762
15 D A -2.5416
16 S A -1.9521
17 A A 0.0000
18 R A -1.1400
19 L A 0.0000
20 S A -0.3635
21 W A 0.0000
22 T A -1.2837
23 A A -1.4333
24 P A -1.3661
25 D A -2.2817
26 A A -1.4791
27 A A -1.1209
28 F A 0.0000
29 D A -2.6025
30 S A -1.5093
31 F A 0.0000
32 A A -0.2216
33 I A 0.0000
34 F A -0.1208
35 Y A -0.5127
36 H A -1.0201
37 E A 0.0000
38 F A 0.0272
39 A A -0.4161
40 N A -1.6431
41 P A -1.1741
42 G A -1.6019
43 E A -2.3132
44 A A -1.0454
45 I A -0.3976
46 D A -1.3333
47 L A -0.2793
48 P A -0.4134
49 V A 0.0000
50 P A -1.1762
51 G A -1.8291
52 S A -1.6433
53 E A -1.5881
54 R A -1.1813
55 S A -0.6633
56 Y A -0.7343
57 D A -1.6344
58 L A 0.0000
59 T A -1.3704
60 G A -1.4388
61 L A 0.0000
62 K A -2.9154
63 P A -2.5616
64 G A -1.8406
65 T A -1.5462
66 E A -1.6400
67 Y A 0.0000
68 D A -1.4215
69 V A 0.0000
70 R A -1.3133
71 I A 0.0000
72 Y A 0.4223
73 G A 0.0000
74 V A -0.6397
75 K A -1.8848
76 G A -1.6031
77 G A -1.2654
78 T A -0.7033
79 A A 0.3765
80 S A 0.0000
81 I A 2.0335
82 P A 0.3958
83 L A -0.6386
84 D A -1.9965
85 A A -1.7234
86 E A -2.2589
87 F A 0.0000
88 T A -1.3636
89 T A -1.8598
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018