Project name: query_structure

Status: done

Started: 2026-03-16 21:45:09
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIAYWEPGIGGEAIWLRVPGSERSYDLTGLKPGTEYKVWIHGVKGGSSSPPLIARFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:37)
Show buried residues

Minimal score value
-3.0674
Maximal score value
1.7879
Average score
-0.6822
Total score value
-61.4004

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0334
2 L A 0.4094
3 P A -0.1982
4 A A -0.5045
5 P A 0.0000
6 K A -2.0469
7 N A -1.3079
8 L A 0.0741
9 V A 0.9484
10 V A 0.0478
11 S A -0.5817
12 R A -1.9795
13 V A -1.0085
14 T A -1.7908
15 E A -3.0674
16 D A -2.7948
17 S A -2.0595
18 A A 0.0000
19 R A -1.1062
20 L A 0.0000
21 S A -0.3677
22 W A 0.0000
23 T A -1.3256
24 A A -1.4233
25 P A -1.3956
26 D A -2.2829
27 A A -1.4246
28 A A -1.1680
29 F A 0.0000
30 D A -2.5470
31 S A 0.0000
32 F A 0.0000
33 N A -0.5989
34 I A 0.0000
35 A A 0.0000
36 Y A 0.5338
37 W A -0.1914
38 E A -0.8922
39 P A -0.6808
40 G A 0.1438
41 I A 1.2491
42 G A -0.1451
43 G A -0.4661
44 E A -1.2871
45 A A -0.0998
46 I A 1.0841
47 W A 1.1570
48 L A 0.1211
49 R A -1.5887
50 V A 0.0000
51 P A -1.5670
52 G A 0.0000
53 S A -1.6568
54 E A -1.7848
55 R A -1.1873
56 S A -0.6214
57 Y A -0.6328
58 D A -1.4547
59 L A 0.0000
60 T A -1.3105
61 G A -1.5156
62 L A 0.0000
63 K A -3.0333
64 P A -2.5908
65 G A -1.8674
66 T A -1.9053
67 E A -2.2797
68 Y A 0.0000
69 K A -0.8508
70 V A 0.0000
71 W A 1.0860
72 I A 0.0000
73 H A -0.2725
74 G A 0.0000
75 V A -1.2704
76 K A -1.7178
77 G A -1.4409
78 G A -1.2014
79 S A -0.7582
80 S A -0.3794
81 S A 0.0000
82 P A 0.2430
83 P A 0.3198
84 L A 0.7684
85 I A 1.7879
86 A A 0.3590
87 R A -1.5360
88 F A 0.0000
89 T A -1.6641
90 T A -1.9369
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018