| Chain sequence(s) |
A: MGSSHHHHHHTGGTTSLHSVPDAFTNPDVATLYQKFLRLQSLEHQRLVSCSDRNSQWSTVDSLSNTSYKKNRYTDIVPYNCTRVHLKRTSPSELDYINASFIKTETSNYIACQGSISRSISDFWHMVWDNVENIGTIVMLGSLFEAGREMCTAYWPSNGIGDKQVYGDYCVKQISEENVDNSRFILRKFEIQNANFPSVKKVHHYQYPNWSDCNSPENVKSMVEFLKYVNNSHGSGNTIVHCSAGVGRTGTFIVLDTILRFPESKLSGFNPSVADSSDVVFQLVDHIRKQRMKMVQTFTQFKYVYDLIDSLQKSQVHFPVLT
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:05:15)
[INFO] Auto_mut: Residue number 48 from chain A and a score of 1.094 (valine) selected for
automated muatation (00:05:17)
[INFO] Auto_mut: Residue number 24 from chain A and a score of 0.921 (phenylalanine)
selected for automated muatation (00:05:17)
[INFO] Auto_mut: Residue number 144 from chain A and a score of 0.910 (phenylalanine)
selected for automated muatation (00:05:17)
[INFO] Auto_mut: Residue number 160 from chain A and a score of 0.862 (isoleucine) selected
for automated muatation (00:05:17)
[INFO] Auto_mut: Residue number 165 from chain A and a score of 0.728 (valine) selected for
automated muatation (00:05:17)
[INFO] Auto_mut: Residue number 196 from chain A and a score of 0.722 (phenylalanine)
selected for automated muatation (00:05:17)
[INFO] Auto_mut: Mutating residue number 48 from chain A (valine) into glutamic acid (00:05:17)
[INFO] Auto_mut: Mutating residue number 48 from chain A (valine) into aspartic acid (00:05:17)
[INFO] Auto_mut: Mutating residue number 24 from chain A (phenylalanine) into glutamic acid
Mutating residue number 24 from chain A (phenylalanine) into glutamic acid (00:05:17)
[INFO] Auto_mut: Mutating residue number 48 from chain A (valine) into lysine (00:07:52)
[INFO] Auto_mut: Mutating residue number 48 from chain A (valine) into arginine (00:07:52)
[INFO] Auto_mut: Mutating residue number 24 from chain A (phenylalanine) into lysine (00:07:58)
[INFO] Auto_mut: Mutating residue number 24 from chain A (phenylalanine) into aspartic acid
Mutating residue number 24 from chain A (phenylalanine) into aspartic acid (00:10:35)
[INFO] Auto_mut: Mutating residue number 144 from chain A (phenylalanine) into glutamic acid
Mutating residue number 144 from chain A (phenylalanine) into glutamic acid (00:10:43)
[INFO] Auto_mut: Mutating residue number 144 from chain A (phenylalanine) into aspartic acid
Mutating residue number 144 from chain A (phenylalanine) into aspartic acid (00:10:48)
[INFO] Auto_mut: Mutating residue number 24 from chain A (phenylalanine) into arginine (00:13:02)
[INFO] Auto_mut: Mutating residue number 144 from chain A (phenylalanine) into arginine (00:13:12)
[INFO] Auto_mut: Mutating residue number 144 from chain A (phenylalanine) into lysine (00:13:19)
[INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into glutamic acid (00:15:37)
[INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into aspartic acid (00:15:52)
[INFO] Auto_mut: Mutating residue number 165 from chain A (valine) into glutamic acid (00:16:04)
[INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into lysine (00:18:06)
[INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into arginine (00:18:16)
[INFO] Auto_mut: Mutating residue number 165 from chain A (valine) into lysine (00:18:29)
[INFO] Auto_mut: Mutating residue number 165 from chain A (valine) into aspartic acid (00:20:47)
[INFO] Auto_mut: Mutating residue number 196 from chain A (phenylalanine) into glutamic acid
Mutating residue number 196 from chain A (phenylalanine) into glutamic acid (00:20:53)
[INFO] Auto_mut: Mutating residue number 196 from chain A (phenylalanine) into aspartic acid
Mutating residue number 196 from chain A (phenylalanine) into aspartic acid (00:21:12)
[INFO] Auto_mut: Mutating residue number 165 from chain A (valine) into arginine (00:23:25)
[INFO] Auto_mut: Mutating residue number 196 from chain A (phenylalanine) into lysine (00:23:32)
[INFO] Auto_mut: Mutating residue number 196 from chain A (phenylalanine) into arginine (00:23:44)
[INFO] Auto_mut: Effect of mutation residue number 48 from chain A (valine) into glutamic
acid: Energy difference: -0.0641 kcal/mol, Difference in average score from
the base case: -0.0289 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 48 from chain A (valine) into lysine:
Energy difference: -0.2131 kcal/mol, Difference in average score from the
base case: -0.0228 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 48 from chain A (valine) into aspartic
acid: Energy difference: 0.3214 kcal/mol, Difference in average score from
the base case: -0.0343 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 48 from chain A (valine) into arginine:
Energy difference: -0.3315 kcal/mol, Difference in average score from the
base case: -0.0286 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 24 from chain A (phenylalanine) into
glutamic acid: Energy difference: 1.4739 kcal/mol, Difference in average
score from the base case: -0.0278 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 24 from chain A (phenylalanine) into
lysine: Energy difference: 1.1667 kcal/mol, Difference in average score
from the base case: -0.0224 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 24 from chain A (phenylalanine) into
aspartic acid: Energy difference: 1.4141 kcal/mol, Difference in average
score from the base case: -0.0239 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 24 from chain A (phenylalanine) into
arginine: Energy difference: 0.9295 kcal/mol, Difference in average score
from the base case: -0.0298 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 144 from chain A (phenylalanine) into
glutamic acid: Energy difference: 1.2090 kcal/mol, Difference in average
score from the base case: -0.0510 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 144 from chain A (phenylalanine) into
lysine: Energy difference: 0.7912 kcal/mol, Difference in average score
from the base case: -0.0406 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 144 from chain A (phenylalanine) into
aspartic acid: Energy difference: 1.5004 kcal/mol, Difference in average
score from the base case: -0.0457 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 144 from chain A (phenylalanine) into
arginine: Energy difference: 0.7987 kcal/mol, Difference in average score
from the base case: -0.0343 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into
glutamic acid: Energy difference: -0.0937 kcal/mol, Difference in average
score from the base case: -0.0357 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into
lysine: Energy difference: -0.1689 kcal/mol, Difference in average score
from the base case: -0.0426 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.6336 kcal/mol, Difference in average
score from the base case: -0.0434 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into
arginine: Energy difference: -0.6576 kcal/mol, Difference in average score
from the base case: -0.0444 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 165 from chain A (valine) into glutamic
acid: Energy difference: -0.4491 kcal/mol, Difference in average score from
the base case: -0.0301 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 165 from chain A (valine) into lysine:
Energy difference: -0.3682 kcal/mol, Difference in average score from the
base case: -0.0335 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 165 from chain A (valine) into aspartic
acid: Energy difference: 0.3481 kcal/mol, Difference in average score from
the base case: -0.0276 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 165 from chain A (valine) into arginine:
Energy difference: -0.2928 kcal/mol, Difference in average score from the
base case: -0.0328 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 196 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.3856 kcal/mol, Difference in average
score from the base case: -0.0132 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 196 from chain A (phenylalanine) into
lysine: Energy difference: -0.1295 kcal/mol, Difference in average score
from the base case: -0.0211 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 196 from chain A (phenylalanine) into
aspartic acid: Energy difference: 0.5025 kcal/mol, Difference in average
score from the base case: -0.0182 (00:26:24)
[INFO] Auto_mut: Effect of mutation residue number 196 from chain A (phenylalanine) into
arginine: Energy difference: -0.0875 kcal/mol, Difference in average score
from the base case: -0.0227 (00:26:24)
[INFO] Main: Simulation completed successfully. (00:26:31)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | M | A | -0.3884 | |
| 2 | G | A | -0.4365 | |
| 3 | S | A | 0.0000 | |
| 4 | S | A | 0.0000 | |
| 5 | H | A | -1.4075 | |
| 6 | H | A | -1.7869 | |
| 7 | H | A | -1.7050 | |
| 8 | H | A | 0.0000 | |
| 9 | H | A | -1.6983 | |
| 10 | H | A | -1.1962 | |
| 11 | T | A | -0.7574 | |
| 12 | G | A | -0.6446 | |
| 13 | G | A | 0.0000 | |
| 14 | T | A | -0.5827 | |
| 15 | T | A | -0.1519 | |
| 16 | S | A | -0.2430 | |
| 17 | L | A | -0.1855 | |
| 18 | H | A | -0.8436 | |
| 19 | S | A | -0.9414 | |
| 20 | V | A | 0.0000 | |
| 21 | P | A | -1.0497 | |
| 22 | D | A | -1.7474 | |
| 23 | A | A | 0.0000 | |
| 24 | F | A | 0.9210 | |
| 25 | T | A | -0.1819 | |
| 26 | N | A | -1.0388 | |
| 27 | P | A | -1.0171 | |
| 28 | D | A | -1.9274 | |
| 29 | V | A | 0.0000 | |
| 30 | A | A | -0.7737 | |
| 31 | T | A | -0.9764 | |
| 32 | L | A | 0.0000 | |
| 33 | Y | A | 0.0000 | |
| 34 | Q | A | -1.2173 | |
| 35 | K | A | 0.0000 | |
| 36 | F | A | 0.0000 | |
| 37 | L | A | -0.0692 | |
| 38 | R | A | -0.6254 | |
| 39 | L | A | 0.0000 | |
| 40 | Q | A | -0.5881 | |
| 41 | S | A | -0.5521 | |
| 42 | L | A | -0.1564 | |
| 43 | E | A | 0.0000 | |
| 44 | H | A | -0.9433 | |
| 45 | Q | A | -0.8017 | |
| 46 | R | A | 0.0000 | |
| 47 | L | A | 0.3965 | |
| 48 | V | A | 1.0942 | |
| 49 | S | A | -0.4076 | |
| 50 | C | A | -0.6191 | |
| 51 | S | A | -1.0302 | |
| 52 | D | A | -2.4957 | |
| 53 | R | A | -3.4218 | |
| 54 | N | A | -2.8541 | |
| 55 | S | A | -1.9115 | |
| 56 | Q | A | -1.8644 | |
| 57 | W | A | -0.9464 | |
| 58 | S | A | 0.0000 | |
| 59 | T | A | 0.0000 | |
| 60 | V | A | -1.0829 | |
| 61 | D | A | -0.9998 | |
| 62 | S | A | 0.0000 | |
| 63 | L | A | -0.1751 | |
| 64 | S | A | -0.7905 | |
| 65 | N | A | -1.4899 | |
| 66 | T | A | -0.9966 | |
| 67 | S | A | 0.0000 | |
| 68 | Y | A | -0.8264 | |
| 69 | K | A | -2.1944 | |
| 70 | K | A | -1.5354 | |
| 71 | N | A | -1.0108 | |
| 72 | R | A | -0.9499 | |
| 73 | Y | A | 0.0000 | |
| 74 | T | A | -1.0166 | |
| 75 | D | A | -1.6411 | |
| 76 | I | A | 0.0000 | |
| 77 | V | A | 0.0000 | |
| 78 | P | A | 0.0000 | |
| 79 | Y | A | 0.0000 | |
| 80 | N | A | -0.7016 | |
| 81 | C | A | 0.3113 | |
| 82 | T | A | -0.0508 | |
| 83 | R | A | 0.0000 | |
| 84 | V | A | 0.0000 | |
| 85 | H | A | -1.7568 | |
| 86 | L | A | 0.0000 | |
| 87 | K | A | -2.7527 | |
| 88 | R | A | -1.9786 | |
| 89 | T | A | -0.9971 | |
| 90 | S | A | -0.9706 | |
| 91 | P | A | -0.8634 | |
| 92 | S | A | -0.9522 | |
| 93 | E | A | -1.6321 | |
| 94 | L | A | -0.9759 | |
| 95 | D | A | -1.6753 | |
| 96 | Y | A | 0.0000 | |
| 97 | I | A | 0.0000 | |
| 98 | N | A | 0.0000 | |
| 99 | A | A | 0.0000 | |
| 100 | S | A | 0.0000 | |
| 101 | F | A | 0.1523 | |
| 102 | I | A | 0.0000 | |
| 103 | K | A | -2.3261 | |
| 104 | T | A | -2.0442 | |
| 105 | E | A | -2.4255 | |
| 106 | T | A | -1.4504 | |
| 107 | S | A | -1.4006 | |
| 108 | N | A | -1.6597 | |
| 109 | Y | A | 0.0000 | |
| 110 | I | A | 0.0000 | |
| 111 | A | A | 0.0000 | |
| 112 | C | A | 0.0000 | |
| 113 | Q | A | 0.0000 | |
| 114 | G | A | 0.0000 | |
| 115 | S | A | 0.0000 | |
| 116 | I | A | -0.8889 | |
| 117 | S | A | -0.9830 | |
| 118 | R | A | -2.2305 | |
| 119 | S | A | 0.0000 | |
| 120 | I | A | -0.4006 | |
| 121 | S | A | -0.4123 | |
| 122 | D | A | 0.0000 | |
| 123 | F | A | 0.0000 | |
| 124 | W | A | 0.0000 | |
| 125 | H | A | -1.0710 | |
| 126 | M | A | 0.0000 | |
| 127 | V | A | 0.0000 | |
| 128 | W | A | -1.2886 | |
| 129 | D | A | -2.3809 | |
| 130 | N | A | -1.5064 | |
| 131 | V | A | 0.0000 | |
| 132 | E | A | -2.9635 | |
| 133 | N | A | -2.1862 | |
| 134 | I | A | -1.4047 | |
| 135 | G | A | 0.0000 | |
| 136 | T | A | 0.0000 | |
| 137 | I | A | 0.0000 | |
| 138 | V | A | 0.0000 | |
| 139 | M | A | 0.0000 | |
| 140 | L | A | 0.0000 | |
| 141 | G | A | 0.0000 | |
| 142 | S | A | 0.2645 | |
| 143 | L | A | 0.6309 | |
| 144 | F | A | 0.9100 | |
| 145 | E | A | -0.2285 | |
| 146 | A | A | -0.4835 | |
| 147 | G | A | -1.0299 | |
| 148 | R | A | -1.7771 | |
| 149 | E | A | -1.1140 | |
| 150 | M | A | 0.0000 | |
| 151 | C | A | 0.0000 | |
| 152 | T | A | -0.0581 | |
| 153 | A | A | -0.0387 | |
| 154 | Y | A | 0.0000 | |
| 155 | W | A | 0.0000 | |
| 156 | P | A | 0.0000 | |
| 157 | S | A | -1.0243 | |
| 158 | N | A | -1.4953 | |
| 159 | G | A | -0.4541 | |
| 160 | I | A | 0.8619 | |
| 161 | G | A | -0.0887 | |
| 162 | D | A | -1.3426 | |
| 163 | K | A | -1.9605 | |
| 164 | Q | A | -0.9673 | |
| 165 | V | A | 0.7276 | |
| 166 | Y | A | 0.1901 | |
| 167 | G | A | -0.5734 | |
| 168 | D | A | -1.2064 | |
| 169 | Y | A | 0.0000 | |
| 170 | C | A | -0.1759 | |
| 171 | V | A | 0.0000 | |
| 172 | K | A | -1.2083 | |
| 173 | Q | A | 0.0000 | |
| 174 | I | A | -0.0775 | |
| 175 | S | A | -0.6425 | |
| 176 | E | A | -1.9948 | |
| 177 | E | A | -3.1883 | |
| 178 | N | A | -3.2461 | |
| 179 | V | A | -2.7735 | |
| 180 | D | A | -3.5963 | |
| 181 | N | A | -3.1980 | |
| 182 | S | A | 0.0000 | |
| 183 | R | A | -3.4715 | |
| 184 | F | A | 0.0000 | |
| 185 | I | A | -1.6340 | |
| 186 | L | A | -1.2838 | |
| 187 | R | A | 0.0000 | |
| 188 | K | A | -0.9001 | |
| 189 | F | A | 0.0000 | |
| 190 | E | A | -0.9664 | |
| 191 | I | A | 0.0000 | |
| 192 | Q | A | -0.3877 | |
| 193 | N | A | 0.0000 | |
| 194 | A | A | -0.4370 | |
| 195 | N | A | -0.8675 | |
| 196 | F | A | 0.7216 | |
| 197 | P | A | 0.2463 | |
| 198 | S | A | 0.0657 | |
| 199 | V | A | 0.2198 | |
| 200 | K | A | -1.1212 | |
| 201 | K | A | -1.3982 | |
| 202 | V | A | 0.0000 | |
| 203 | H | A | -0.6481 | |
| 204 | H | A | 0.0000 | |
| 205 | Y | A | 0.0000 | |
| 206 | Q | A | 0.0000 | |
| 207 | Y | A | 0.0000 | |
| 208 | P | A | -0.7203 | |
| 209 | N | A | -1.7060 | |
| 210 | W | A | 0.0000 | |
| 211 | S | A | -0.4591 | |
| 212 | D | A | -0.4029 | |
| 213 | C | A | 0.2388 | |
| 214 | N | A | -0.6575 | |
| 215 | S | A | -1.1108 | |
| 216 | P | A | -1.7084 | |
| 217 | E | A | -2.6514 | |
| 218 | N | A | -2.1900 | |
| 219 | V | A | 0.0000 | |
| 220 | K | A | -2.8400 | |
| 221 | S | A | -2.7920 | |
| 222 | M | A | 0.0000 | |
| 223 | V | A | -1.4285 | |
| 224 | E | A | -2.3795 | |
| 225 | F | A | 0.0000 | |
| 226 | L | A | 0.0000 | |
| 227 | K | A | -1.4095 | |
| 228 | Y | A | -0.8238 | |
| 229 | V | A | 0.0000 | |
| 230 | N | A | -1.3817 | |
| 231 | N | A | -1.7769 | |
| 232 | S | A | -1.2220 | |
| 233 | H | A | -1.5293 | |
| 234 | G | A | -1.5411 | |
| 235 | S | A | -1.5616 | |
| 236 | G | A | -1.8597 | |
| 237 | N | A | -1.2923 | |
| 238 | T | A | -0.5287 | |
| 239 | I | A | 0.0000 | |
| 240 | V | A | 0.0000 | |
| 241 | H | A | 0.0000 | |
| 242 | C | A | 0.0000 | |
| 243 | S | A | 0.0000 | |
| 244 | A | A | 0.0000 | |
| 245 | G | A | 0.0000 | |
| 246 | V | A | 0.0000 | |
| 247 | G | A | 0.0000 | |
| 248 | R | A | 0.0000 | |
| 249 | T | A | 0.0000 | |
| 250 | G | A | 0.0000 | |
| 251 | T | A | 0.0000 | |
| 252 | F | A | 0.0000 | |
| 253 | I | A | 0.0000 | |
| 254 | V | A | 0.0000 | |
| 255 | L | A | 0.0000 | |
| 256 | D | A | 0.0000 | |
| 257 | T | A | 0.0000 | |
| 258 | I | A | 0.0000 | |
| 259 | L | A | 0.0000 | |
| 260 | R | A | -0.9386 | |
| 261 | F | A | 0.0000 | |
| 262 | P | A | -1.2238 | |
| 263 | E | A | -1.6887 | |
| 264 | S | A | -1.2982 | |
| 265 | K | A | -1.7050 | |
| 266 | L | A | 0.0000 | |
| 267 | S | A | -1.0402 | |
| 268 | G | A | -0.8648 | |
| 269 | F | A | -0.7068 | |
| 270 | N | A | -1.1253 | |
| 271 | P | A | -0.9624 | |
| 272 | S | A | -0.6479 | |
| 273 | V | A | -0.0323 | |
| 274 | A | A | -0.1421 | |
| 275 | D | A | -0.5391 | |
| 276 | S | A | -0.4727 | |
| 277 | S | A | -0.4382 | |
| 278 | D | A | 0.0000 | |
| 279 | V | A | -0.2444 | |
| 280 | V | A | 0.0000 | |
| 281 | F | A | 0.0000 | |
| 282 | Q | A | -0.8552 | |
| 283 | L | A | 0.0000 | |
| 284 | V | A | 0.0000 | |
| 285 | D | A | 0.0000 | |
| 286 | H | A | -1.4271 | |
| 287 | I | A | 0.0000 | |
| 288 | R | A | 0.0000 | |
| 289 | K | A | -1.0863 | |
| 290 | Q | A | -0.6806 | |
| 291 | R | A | 0.0000 | |
| 292 | M | A | 0.0000 | |
| 293 | K | A | -0.5976 | |
| 294 | M | A | 0.0000 | |
| 295 | V | A | 0.0000 | |
| 296 | Q | A | 0.0000 | |
| 297 | T | A | -0.2787 | |
| 298 | F | A | 0.0000 | |
| 299 | T | A | -0.2900 | |
| 300 | Q | A | 0.0000 | |
| 301 | F | A | 0.0000 | |
| 302 | K | A | -0.5654 | |
| 303 | Y | A | 0.0000 | |
| 304 | V | A | 0.0000 | |
| 305 | Y | A | 0.0000 | |
| 306 | D | A | -0.9922 | |
| 307 | L | A | 0.0000 | |
| 308 | I | A | 0.0000 | |
| 309 | D | A | -1.8948 | |
| 310 | S | A | -1.7999 | |
| 311 | L | A | 0.0000 | |
| 312 | Q | A | -2.7011 | |
| 313 | K | A | -2.8021 | |
| 314 | S | A | -2.0361 | |
| 315 | Q | A | -2.3223 | |
| 316 | V | A | -1.2371 | |
| 317 | H | A | -1.4511 | |
| 318 | F | A | 0.0000 | |
| 319 | P | A | -0.8801 | |
| 320 | V | A | 0.0000 | |
| 321 | L | A | 0.0000 | |
| 322 | T | A | -0.5755 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| IR160A | -0.6576 | -0.0444 | View | CSV | PDB |
| VK165A | -0.3682 | -0.0335 | View | CSV | PDB |
| VE165A | -0.4491 | -0.0301 | View | CSV | PDB |
| IK160A | -0.1689 | -0.0426 | View | CSV | PDB |
| VR48A | -0.3315 | -0.0286 | View | CSV | PDB |
| VE48A | -0.0641 | -0.0289 | View | CSV | PDB |
| FR196A | -0.0875 | -0.0227 | View | CSV | PDB |
| FK196A | -0.1295 | -0.0211 | View | CSV | PDB |
| FK144A | 0.7912 | -0.0406 | View | CSV | PDB |
| FR144A | 0.7987 | -0.0343 | View | CSV | PDB |
| FR24A | 0.9295 | -0.0298 | View | CSV | PDB |
| FK24A | 1.1667 | -0.0224 | View | CSV | PDB |