Project name: query_structure

Status: done

Started: 2026-03-16 22:49:23
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVSGSKSTATISGLKPGVDYTITVYAKYLWYSGYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-2.6137
Maximal score value
2.7177
Average score
-0.283
Total score value
-26.0394

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8025
2 S A 0.7806
3 S A 0.6136
4 V A 0.3948
5 P A 0.0000
6 T A -1.6418
7 K A -2.6137
8 L A -1.6642
9 E A -1.8484
10 V A 0.1322
11 V A 1.5578
12 A A 0.9034
13 A A 0.3074
14 T A -0.3401
15 P A -1.1105
16 T A -0.9940
17 S A -0.5242
18 L A 0.0000
19 L A 0.7596
20 V A 0.0000
21 S A -0.9123
22 W A 0.0000
23 D A -2.6115
24 A A -1.2301
25 P A 0.0230
26 A A 0.5042
27 V A 1.0544
28 T A 0.7969
29 V A 0.0000
30 V A 1.4132
31 F A 1.2658
32 Y A 0.0000
33 D A -0.0308
34 I A 0.0000
35 T A -0.4736
36 Y A -0.2938
37 G A 0.0000
38 E A -1.6172
39 T A -1.2867
40 G A -1.2565
41 G A -1.4291
42 N A -1.5599
43 S A -0.8923
44 P A -0.3408
45 V A 0.4151
46 Q A -0.8501
47 E A -1.5893
48 F A -0.5598
49 T A 0.0983
50 V A 0.1879
51 S A -0.0492
52 G A -0.0055
53 S A -0.6991
54 K A -1.6365
55 S A -1.1811
56 T A -0.6738
57 A A 0.0000
58 T A 0.2690
59 I A 0.0000
60 S A -0.6536
61 G A -1.0257
62 L A 0.0000
63 K A -2.3700
64 P A -1.6453
65 G A -1.4425
66 V A -1.4212
67 D A -2.1349
68 Y A 0.0000
69 T A -0.7965
70 I A 0.0000
71 T A -0.1308
72 V A 0.0000
73 Y A 0.5784
74 A A 0.0000
75 K A 1.2630
76 Y A 0.0000
77 L A 2.7177
78 W A 2.5053
79 Y A 2.3439
80 S A 1.0897
81 G A 1.0457
82 Y A 1.1289
83 S A 0.0000
84 S A 0.0863
85 P A 0.1241
86 I A -0.0050
87 S A -0.5587
88 I A -0.7173
89 N A -1.7464
90 Y A -1.4766
91 R A -2.5322
92 T A -1.6295
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018